PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G087800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family EIL
Protein Properties Length: 394aa    MW: 40604.8 Da    PI: 4.417
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G087800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN383.74.6e-2665191136257
                         STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--......-----GGG--HHHHHHHHHHHHHHTGGGH CS
                EIN3 136 lselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqg.....tppykkphdlkkawkvsvLtavikhmspti 221
                         l  + +  lg++Lsalm  cdpp  + +  +g +pPWWPt  e+wwg   +++        + p+     lkk+ kv+vL av+kh+sp++
  Sevir.2G087800.1.p  65 LDRIKNNALGAMLSALMLSCDPPVGQRQGWTGAPPPWWPTAAEDWWGPEVVAHLNTmpahtPVPFAPAYKLKKVQKVGVLVAVVKHLSPDF 155
                         566778889**************************************6654443334677677999999********************** PP

                         HHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S CS
                EIN3 222 eeirelerqskylqdkmsakesfallsvlnqeekec 257
                         + i e ++ s+  + k +a e+  + s l++e +  
  Sevir.2G087800.1.p 156 DGISEKVEVSQNAKAKLTAEEKNLWKSALENEAARH 191
                         ******************************997754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.3180.104.4E-3859191IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048737.8E-2663187No hitNo description
SuperFamilySSF1167683.92E-3463190IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MAGVNGAALH WSTAATLGAA GQAVAALPLS AIAGVNGPAA APLVVGPMLI GPPAPAVGLP  60
LAVALDRIKN NALGAMLSAL MLSCDPPVGQ RQGWTGAPPP WWPTAAEDWW GPEVVAHLNT  120
MPAHTPVPFA PAYKLKKVQK VGVLVAVVKH LSPDFDGISE KVEVSQNAKA KLTAEEKNLW  180
KSALENEAAR HKSGSVPMVP VFNFVLQQQQ QQAPPPPPPH GDGHRLAPIG GATTENVVRG  240
GVAVAAADGR EQQVVNVNLA GASVTAPAGD GGQAVAAAET EQHGDGALHG GAMAADGGSE  300
KPVDIPGDDG VPLLGDDVHQ VAAEPEQQGL INISDAAAAD MDQLLNDMLA PYQMQQVAVE  360
EAPEARPWYV EEDMSSFFDD FEVPGVTPHP YYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-21641895125Protein ETHYLENE INSENSITIVE 3
4zds_B1e-21641895125Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G087800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4A2T80.0K4A2T8_SETIT; Uncharacterized protein
STRINGSi033190m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15037818