PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G055300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 849aa    MW: 91553.3 Da    PI: 7.5143
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G055300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.5e-16535573240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Sevir.2G055300.2.p 535 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 573
                         589**********************************96 PP

2TCR50.15.6e-16620659140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  Sevir.2G055300.2.p 620 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 659
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17534575IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.046535660IPR005172CRC domain
PfamPF036389.7E-12537572IPR005172CRC domain
SMARTSM011143.5E-16620661IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11622658IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MAGSPAASVG ACTSYPNTTH APIQSNRREP CARLLALRRR PAGQLASSAC RHVSPCGVSL  60
IADHEADRAP SKCRPMRPPH HDNTGKHYGQ GRMLHRCSRS AEERIAAPEM DTPDRAAAQP  120
AASRAEDSPV FSFINNLSPI EPLKSAYNAN SLQGYQSINI TSISSIFTSP HDNAHKEPRL  180
PKSSLGEISE SEVCADGKNT NKPTKSSNAV RLFACTSTVT QETHTVTCSD VVDPPTVPCD  240
LAQPAQFDNG SPDHNTTPCH GVRSDLKQDK CRKQDVVQTV KSTVEKRKCL FSTEIQLLDG  300
GQPVNDNNEV LGCEWSDLIA TTSGDGEISE RAYPNASGQV YYQELVMGED QTENAQIFQD  360
GQQTISTEEI QDNIYEANGC IPLDYKVESQ QQRGVRRRCL VFEAAGFSNS VVQKESVEDL  420
SVSTCKGKGH VQTQPRGLRG IGLHLNALAL TPKGKMACQD PMASALLPSS ASEKDAHGKL  480
LCAGENFTHS GGELLEFPMD DCSSGGFPLN DHVSSQSVSP QKKRRKTDNG DDGEACKRCS  540
CKKSKCLKLY CECFAAGVYC SEPCSCQGCL NKPIHEEIVL STRKQIEFRN PLAFAPKVIR  600
MSDAGLETGE DPNNTPASAR HKRGCNCKKS SCLKKYCECY QGGVGCSSNC RCESCKNTFG  660
RRDAETELTE EMKQEGEQTE NSGKEKENDQ QKANVQSEDH PLVELVPITP PFDLSSSLLK  720
LPNFSSAKPP RPSKARSGSS RSSASKATTT LQSCKSSKAA GSGIDEEMLD ILKEADSPSR  780
VKTTSPNRKR VSPPHNALSI SPNRKGGRKL ILKSIPSFPS LTGDSNSGSA MNNTDNTFSA  840
SPLALGPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1553765712120Protein lin-54 homolog
5fd3_B4e-1553765712120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1521525KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G055300.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955607.10.0protein tesmin/TSO1-like CXC 2 isoform X2
TrEMBLA0A368PV870.0A0A368PV87_SETIT; Uncharacterized protein
STRINGSi028949m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.18e-81TESMIN/TSO1-like CXC 2