PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G055300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 884aa    MW: 95338.6 Da    PI: 7.3673
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G055300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.7e-16570608240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Sevir.2G055300.1.p 570 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 608
                         589**********************************96 PP

2TCR505.8e-16655694140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  Sevir.2G055300.1.p 655 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 694
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17569610IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.046570695IPR005172CRC domain
PfamPF036381.0E-11572607IPR005172CRC domain
SMARTSM011143.5E-16655696IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11657693IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 884 aa     Download sequence    Send to blast
MAGSPAASVG ACTSYPNTTH APIQSNRREP CARLLALRRR PAGQLASSAC RHVSPCGVSL  60
IADHEADRAP SKCRPMRPPH HDNTGKHYGQ GRMLHRCSRS AEERIAAPEM DTPDRAAAQP  120
AASRAEDSPV FSFINNLSPI EPLKSAYNAN SLQGYQSINI TSISSIFTSP HDNAHKEPRL  180
PKSSLGEISE SEVCADGKNT NKPTKSSNAV RLFACTSTVT QETHTVTCSD VVDPPTVPCD  240
LAQPAQFDNG SPDHNTTPCH GVRSDLKQDK CRKQDVVQTV KSTVEKRKCL FSTEIQLLDG  300
GQPVNDNNEV LGCEWSDLIA TTSGELLAFD STMDDHHRGM HLAAKNAESC GYLLSKLAGD  360
GEISERAYPN ASGQVYYQEL VMGEDQTENA QIFQDGQQTI STEEIQDNIY EANGCIPLDY  420
KVESQQQRGV RRRCLVFEAA GFSNSVVQKE SVEDLSVSTC KGKGHVQTQP RGLRGIGLHL  480
NALALTPKGK MACQDPMASA LLPSSASEKD AHGKLLCAGE NFTHSGGELL EFPMDDCSSG  540
GFPLNDHVSS QSVSPQKKRR KTDNGDDGEA CKRCSCKKSK CLKLYCECFA AGVYCSEPCS  600
CQGCLNKPIH EEIVLSTRKQ IEFRNPLAFA PKVIRMSDAG LETGEDPNNT PASARHKRGC  660
NCKKSSCLKK YCECYQGGVG CSSNCRCESC KNTFGRRDAE TELTEEMKQE GEQTENSGKE  720
KENDQQKANV QSEDHPLVEL VPITPPFDLS SSLLKLPNFS SAKPPRPSKA RSGSSRSSAS  780
KATTTLQSCK SSKAAGSGID EEMLDILKEA DSPSRVKTTS PNRKRVSPPH NALSISPNRK  840
GGRKLILKSI PSFPSLTGDS NSGSAMNNTD NTFSASPLAL GPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1557269212120Protein lin-54 homolog
5fd3_B4e-1557269212120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1556560KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G055300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955606.10.0protein tesmin/TSO1-like CXC 3 isoform X1
TrEMBLA0A368PV870.0A0A368PV87_SETIT; Uncharacterized protein
STRINGSi028949m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-79TESMIN/TSO1-like CXC 2