PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G033300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 953aa    MW: 104928 Da    PI: 10.4807
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G033300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.66e-08324369146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r +WT++E+ +l+  v++ G  +W  Ia+t+g+ Rt+ qc  r+q 
  Sevir.2G033300.1.p 324 REAWTAQEETKLLLIVQEKGLYNWINIAATLGTYRTPFQCLVRYQR 369
                         789*****************************99*******99995 PP

2Myb_DNA-binding45.61.6e-14378422248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         ++WT+eEd++l  av+ +G + W ++++ +  gRt+ qc +rw+k l
  Sevir.2G033300.1.p 378 KAWTKEEDLQLRAAVHTFGEK-WQLVSASLD-GRTGSQCSNRWRKTL 422
                         58*******************.*********.************975 PP

3Myb_DNA-binding35.52.3e-11430474247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         grW  +Ed++l   vk+ G+g+W++Ia  ++ gRt  qc +rw + 
  Sevir.2G033300.1.p 430 GRWHLDEDKRLMVSVKLIGSGSWSKIAPFIP-GRTQPQCHERWCNI 474
                         89*****************************.***********996 PP

4Myb_DNA-binding409.1e-13482526247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         g+W +eEd +l+ av ++G+  W++Ia  +  gR +++c  rw+k+
  Sevir.2G033300.1.p 482 GKWRPEEDTKLLAAVSEFGPC-WSKIAMNIIPGRNDNMCSRRWNKL 526
                         79*****************88.*****99999************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.063220316IPR017877Myb-like domain
SMARTSM007171.0E-4224320IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-12226243IPR009057Homeodomain-like
CDDcd001670.00209289316No hitNo description
Gene3DG3DSA:1.10.10.603.3E-12290331IPR009057Homeodomain-like
SuperFamilySSF466897.26E-15300368IPR009057Homeodomain-like
PROSITE profilePS500908.699319371IPR017877Myb-like domain
SMARTSM007173.2E-6323373IPR001005SANT/Myb domain
PfamPF002494.6E-6324369IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-11332377IPR009057Homeodomain-like
SuperFamilySSF466896.96E-21356425IPR009057Homeodomain-like
PROSITE profilePS5129419.409372426IPR017930Myb domain
SMARTSM007173.0E-13376424IPR001005SANT/Myb domain
PfamPF002493.1E-13378421IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-16378424IPR009057Homeodomain-like
CDDcd001671.38E-10379422No hitNo description
PROSITE profilePS500909.721424475IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.9E-15427475IPR009057Homeodomain-like
SuperFamilySSF466895.87E-23427523IPR009057Homeodomain-like
SMARTSM007174.5E-8428477IPR001005SANT/Myb domain
PfamPF002491.2E-9430475IPR001005SANT/Myb domain
CDDcd001672.18E-7431475No hitNo description
Gene3DG3DSA:1.10.10.607.4E-17476530IPR009057Homeodomain-like
PROSITE profilePS5129417.57476531IPR017930Myb domain
SMARTSM007171.7E-10480529IPR001005SANT/Myb domain
PfamPF002499.8E-11482526IPR001005SANT/Myb domain
CDDcd001671.88E-9483526No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 953 aa     Download sequence    Send to blast
MDFYSDDSDP DIDEDLREDL DALRRSCILS GADPDAAVAQ VSSGLAGPST PALAAATTTA  60
AAGTSTSSPK AMKPEASQGV HGELFVDRND DESAAQKQNA KAHNRTGFPK AALLLVDALK  120
KNRACQKLIR RKLINIEAKI EENKDLRDRV KCLLGYQLSC RRSAGRSLSQ KEDPRIRLIS  180
SRKPTQLSEK NNNRKMPALF LGPAENPRVS KYRMVLEQFP MSFKKQPWSD AEKDKLARGI  240
KQQYQETLIL DSLNNGSAIG DFSAVDMAYA LTNGVGNFEV TPESLRSVLP LINWDKISAM  300
YLPGRSGAEC ESRWLNCDDP LINREAWTAQ EETKLLLIVQ EKGLYNWINI AATLGTYRTP  360
FQCLVRYQRS LNPHIINKAW TKEEDLQLRA AVHTFGEKWQ LVSASLDGRT GSQCSNRWRK  420
TLHPTRTRVG RWHLDEDKRL MVSVKLIGSG SWSKIAPFIP GRTQPQCHER WCNILDPSID  480
LGKWRPEEDT KLLAAVSEFG PCWSKIAMNI IPGRNDNMCS RRWNKLCKHH LPAVKAAIQL  540
KKSVFQTNFV DREKERPAIA PSDLISLVQS KGDESGENTR DRSRKQTKEN LVASNIVNSS  600
AAPDCVAANT VSNTSSRRPS RKSTGRRSKK QNEENVAVPD GLNDLSSSRS RSRKRKSTSG  660
SNAAVQKRMR GSIPVGNEAV PIELRGTVSA DNEVGTNRIM DPLSVGVEGV VKKRTRGSKP  720
AGNNAASQKR MRGSIPVGNE AVPIEVSAND EVGTNRMMDP ASVGEEGVVK KRTRRSKPAG  780
SEGAARKRRC TISADNEAGT NTRDPVSGEE EVVKKRKRRS KPVGNEGAAR KRMRGSVSVG  840
DEGVVEKRTG SVATENHGDV TKRKRAPSRR KSAEDNLTTE GPANATPELG LPSAPSEERV  900
VDAGNMDKGK RKSTPRPKHI NIEGDADKHS PSARLANCLS FARMKGINRN KR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-242965353155MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-242965353155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1651656SRKRKS
2769788KKRTRRSKPAGSEGAARKRR
3813818KKRKRR
4814831KRKRRSKPVGNEGAARKR
5828834ARKRMRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660280.10.0PREDICTED: uncharacterized protein LOC101780859
TrEMBLA0A096QN110.0A0A096QN11_MAIZE; Uncharacterized protein
STRINGGRMZM2G051793_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-145myb domain protein 4r1