PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G345300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 381aa    MW: 41603.4 Da    PI: 8.5409
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G345300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.1e-2589132144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Sevir.1G345300.1.p  89 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 132
                         79***************************************998 PP

2QLQ58.12.7e-201852236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ +++
  Sevir.1G345300.1.p 18 PFTASQWQELEHQALIYKCLASGKPIPSYLMPPLR 52
                        9******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.1E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.8141853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.5E-141850IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57389133IPR014977WRC domain
PfamPF088792.0E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MMMMSGRAGG GATAGRYPFT ASQWQELEHQ ALIYKCLASG KPIPSYLMPP LRRILDSALA  60
TSPSLAFPPQ PSLGWGCFGM GFSRKPDEDP EPGRCRRTDG KKWRCSKEAY PDSKYCEKHM  120
HRGKNRSRKP VEMSLATPAP SSNASSAASA TTTTSSPAPT YHRPAPTAHD AAPYHALYGG  180
GSPYAASARP AGAYHAAQVS PFHLHLDTTH PHPPLPPSYY SVDQRDYAYG HTAKEVGEHA  240
FFSDSTTERD RQQAAGQWQF KNLGMEPKHS AAPLFSAGGY GNGAASAYAV DLTREDDEER  300
RRQQQQHCFV LGADLRLERP SGHDAAPEQK PLRPFFDEWP HEKANKGGSW MGLDGETQLS  360
MSIPMATNDL PITSRYRNGA *
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.1G345300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1846770.0KF184677.1 Saccharum hybrid cultivar R570 clone BAC 101B12 complete sequence.
GenBankKF1847360.0KF184736.1 Saccharum hybrid cultivar R570 clone BAC 053L01 complete sequence.
GenBankKF1847720.0KF184772.1 Saccharum hybrid cultivar R570 clone BAC 022O20 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701613.10.0growth-regulating factor 1 isoform X2
SwissprotQ6AWY81e-170GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLK3YTB60.0K3YTB6_SETIT; Uncharacterized protein
STRINGSi017515m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-49growth-regulating factor 5