PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G121600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 427aa    MW: 46736.8 Da    PI: 6.4957
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G121600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.9e-1671110140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         k++kgC+Ckks ClkkYCeC++a++ Cs++C+C dCkN e
  Sevir.1G121600.2.p  71 KHNKGCHCKKSGCLKKYCECYQANVLCSKNCRCMDCKNFE 110
                         589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011140.47126IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.4951111IPR005172CRC domain
SMARTSM011142.0E-1871112IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.4E-1274109IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MYCECFQELQ FCDGCNCSNC GNIVGNEKAR NEAMEAIRQR NPLAFQPKIE NGPSTHNVRK  60
DTSGAVPLVP KHNKGCHCKK SGCLKKYCEC YQANVLCSKN CRCMDCKNFE GSEERKALVQ  120
GDYASDGNQT QQAARVAING TIGSSGYNHS PVRRKRSRED AVGIRINSEG SMPETQFQQG  180
NHADTSLLAP YSTGFDGHSA ANSQSKSYNP IYRSPLANTI HLSEVNDLVT QLVTVCRMAA  240
ATIADNKVDG TTVEKEFHVN GELSNGNCKQ QQLSEASRMD ILTRGCSDPP NSNEMDSHWS  300
DTAKDSRPAS PTTQALMCDE QDTSFGNDYR SSYPSVSCDQ DISEINAAQE NLVLTGLREY  360
LRVIITRGKI NEHKSSSEAA MELDGRQHGA MPAFAPREVR ENIPSSNGIE TPGINQKLTH  420
DDGSKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-21112024132Protein lin-54 homolog
5fd3_B2e-21112024132Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.1G121600.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952204.10.0protein tesmin/TSO1-like CXC 5
TrEMBLK3YRR50.0K3YRR5_SETIT; Uncharacterized protein
STRINGSi016959m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-82Tesmin/TSO1-like CXC domain-containing protein