PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400069435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 554aa    MW: 63256.6 Da    PI: 5.5327
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400069435genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like391.8e-12216255444
               G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtle 44 
                           ++W+ +LH++F+e +eqL G+ +  Pk i+e+m+v gLt+ 
  PGSC0003DMP400069435 216 VKWNADLHAKFMESLEQL-GEGRCYPKDIVEVMDVSGLTRM 255
                           79****************.9*******************85 PP

2Response_reg29.83.1e-11141171105
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           v++vd e  +   +  +l++ +y +v ++++++ea+e+l + +  +D+i++ +  +++d +++l +  + +  +  ++v ++ +e +a+
  PGSC0003DMP400069435  14 VVLVDPETENVTEMVDLLKSYDY-KVITVRTSSEAMEMLSKGEkkVDVIIISVHSSNLDSFKFLAQVMTLD--IISLFVCDEYNELLAK 99 
                           689999*****************.999************555555**********************9988..777777788889**** PP

                           HHHHTTESEEEESS--HH CS
          Response_reg  88 ealkaGakdflsKpfdpe 105
                           +alk Ga  f+  p ++e
  PGSC0003DMP400069435 100 KALKEGACLFVQRPLNEE 117
                           **************7765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23007.7E-1411145No hitNo description
SuperFamilySSF521724.55E-1411134IPR011006CheY-like superfamily
SMARTSM004480.006612122IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011023.82113127IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.8E-514117IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.00E-616117No hitNo description
SuperFamilySSF466895.02E-6211256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-10212255IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-8213256IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MATGYYGIIH EVRVVLVDPE TENVTEMVDL LKSYDYKVIT VRTSSEAMEM LSKGEKKVDV  60
IIISVHSSNL DSFKFLAQVM TLDIISLFVC DEYNELLAKK ALKEGACLFV QRPLNEEIMK  120
YLWQFVLRRK IEREKAKKGS EDRDKMIVKD VDTNNMDEDN EVLSKETNDV ANTEEHRNNI  180
DEVEDNITSN GKYKRRRENN RKDRKKDKVI KQKNCVKWNA DLHAKFMESL EQLGEGRCYP  240
KDIVEVMDVS GLTRMQKCRF NNWKSPEEHK SNRRLSGQES LSESRQKSSN RKYGTMPRLQ  300
NNIPNQIQRG PQFPFSTLNT SNIFARGVSS IQEKLYPPQF QVQPHYPNID NSLNNPFLSV  360
QNNVGGVLQQ HQHRPLLEMF GSLRLQDPII GNITHRPGSA FNTWNRHTQS EYYLDLNVAH  420
KTTHSGSKIM HDIGVENTTI NDYNLNVIAG NTNTDSGSTM MSDTDAENAT SDELGTINAN  480
FQQHIVEPNM SYPSNIATTY KSDIEGSDSN EKEDCDAYSN FNNMGCFFQN IGPPGANLPN  540
SYDSEFDQVY SDD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400069435
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015168455.10.0PREDICTED: uncharacterized protein LOC107062391
TrEMBLM1E1C80.0M1E1C8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000977600.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.15e-19response regulator 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]