PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400067675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 233aa    MW: 27844.1 Da    PI: 10.633
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400067675genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM62.51.3e-1951293128
                   NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykv.ePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk.atgk 88 
                           +G+ FhPtd el+ +yLk+  +g+    +++ i+ +diy    Pw++   ++ eek   f ++ +k +++ kr +r+ ++g+Wk +tg+
  PGSC0003DMP400067675   5 MGICFHPTDTELI-NYLKRFFKGELSLNQQCpIQFADIYGDqPPWEIF-GANFEEKFRCFITPLKKLKTEYKRFSRICAKGTWKgQTGE 91 
                           7999*********.9*******9985444556*******87368***6.555567777899999999999**************88888 PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           + +  +++  +vg k+ L f   +++ g+k +W+m ey++
  PGSC0003DMP400067675  92 HLTRRNRTAPVVGFKRNLKFE--TSECGQKNTWLMVEYHV 129
                           88888878889*********8..88999**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100523.5753153IPR003441NAC domain
PfamPF023654.0E-135129IPR003441NAC domain
SuperFamilySSF1019414.05E-215153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MSKQMGICFH PTDTELINYL KRFFKGELSL NQQCPIQFAD IYGDQPPWEI FGANFEEKFR  60
CFITPLKKLK TEYKRFSRIC AKGTWKGQTG EHLTRRNRTA PVVGFKRNLK FETSECGQKN  120
TWLMVEYHVA DSFFKENNHI LKEDFVVCRI KKKKMGKEKN VDHVMRHKLE MLRELLILCC  180
LNLIIIKTTP QGKIKLGFVM NKMQLRLQLR NMMFKTVLMK LLQWRRERQR WK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400067675
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345191.11e-111PREDICTED: NAC transcription factor 29-like
TrEMBLM1DXH71e-171M1DXH7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000960001e-172(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8141386
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.11e-12NAC domain containing protein 96
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]