PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400066099
Common NameLOC107057950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TCP
Protein Properties Length: 246aa    MW: 26285.1 Da    PI: 10.2744
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400066099genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP87.72.7e-2741110473
                   TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                            k+r +  hTkv+gR+ RvRls  caar+F+L++eLG+++  +t+ W l+ a+pai+++tgt++++ ++ 
  PGSC0003DMP400066099  41 VKKRAKYKHTKVEGRGTRVRLSPICAARIFQLTQELGHKSEAETLKWILEHAEPAIIAATGTGTIPTNAI 110
                           58999*********************************************************99999665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-2145113IPR005333Transcription factor, TCP
PROSITE profilePS5136918.744599IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MVNVDQNKQK VDDNGTKVLG ADPLLGDSHE SAIAVDLSQV VKKRAKYKHT KVEGRGTRVR  60
LSPICAARIF QLTQELGHKS EAETLKWILE HAEPAIIAAT GTGTIPTNAI QVNGMFKIPA  120
TINDGESFVR KRKRAFNSEF YDVHEKSKFA PVAPIAPKGV VPVWPVGNGY YMPPPVARPH  180
LWASPLINVN AVGAGELKLS SSCVSKSAGN GNKLGDGVSV MAPSSTSTSL LATTTTTRRF  240
SKETL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400066099
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015158607.10.0PREDICTED: transcription factor TCP9-like
SwissprotO646474e-39TCP9_ARATH; Transcription factor TCP9
TrEMBLM1DU440.0M1DU44_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000944240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-29TCP family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]