PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400063946
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HB-other
Protein Properties Length: 266aa    MW: 30327.3 Da    PI: 5.1437
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400063946genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.28e-1553107256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +k  +++++q++eL  +F+kn+ p+++ r eLA+kl+++ + V +WFqN+R+++k
  PGSC0003DMP400063946  53 KKPIRHNADQIQELGLFFKKNSLPNKKVRLELATKLSMDINHVENWFQNKRTQMK 107
                           56667899********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-1441107IPR009057Homeodomain-like
SuperFamilySSF466894.6E-1442107IPR009057Homeodomain-like
PROSITE profilePS5007114.25249109IPR001356Homeobox domain
SMARTSM003892.4E-1051113IPR001356Homeobox domain
CDDcd000862.00E-1052107No hitNo description
PfamPF000462.2E-1253107IPR001356Homeobox domain
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEGHSDMNER KESLINVVIG RPGEEEIERS FIGDNITGGA SVDEHGESSS KRKKPIRHNA  60
DQIQELGLFF KKNSLPNKKV RLELATKLSM DINHVENWFQ NKRTQMKLQL ELYENKTLKQ  120
ENDKLHIENI VMMEALENSI RDNCKENIDE NQIKIEHDQL EDEVKRLTTQ AYKLSLFNKD  180
VVQDKMVLLN LAMDALNELF RLYENDKPLW VSSLDGGGET LNIKEYARLF TPLIGTKLEH  240
FTTEATRASG TVADTSLALV NTLNG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015160167.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
TrEMBLM1DPG20.0M1DPG2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000922710.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1581346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.25e-46HD-ZIP family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]