PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400062677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ERF
Protein Properties Length: 219aa    MW: 24943.9 Da    PI: 8.6457
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400062677genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP261.12.5e-1984136256
                   AP2   2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 
                           +y+GVr+++ +g+++AeIrdp+  g + r++lg++ t+e+Aa a+++a+ k++g+
  PGSC0003DMP400062677  84 RYRGVRRRP-WGKFAAEIRDPKRKG-NNRVWLGTYETPEDAALAYDRAAYKMRGA 136
                           7********.**********85533.59*************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003805.7E-3384149IPR001471AP2/ERF domain
PfamPF008473.1E-1484135IPR001471AP2/ERF domain
SuperFamilySSF541712.29E-2184144IPR016177DNA-binding domain
PROSITE profilePS5103224.15784143IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.102.3E-3084144IPR001471AP2/ERF domain
PRINTSPR003675.1E-138596IPR001471AP2/ERF domain
CDDcd000189.59E-2592145No hitNo description
PRINTSPR003675.1E-13125145IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MNPPEIITLE DFDLNNILFY DSMEHYFSEN SDIIFSEISS VNNNNNNNIT IDSSQILVNH  60
DIPSPTKLSS TEERHVDAPP SWRRYRGVRR RPWGKFAAEI RDPKRKGNNR VWLGTYETPE  120
DAALAYDRAA YKMRGARALL NFPHLIGSNV GDYNRVYPKR RLNSLDENSI STTKTSNNIE  180
CSPSPKRRNV ELINSLAKAK ASLNSHCIME RFELGNLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gcc_A5e-2983143160ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR 1
2gcc_A7e-2983148468ATERF1
3gcc_A7e-2983148468ATERF1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400062677
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754402e-65HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015164457.11e-143PREDICTED: ethylene-responsive transcription factor 2-like
TrEMBLM1DLP21e-159M1DLP2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000910021e-160(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21241165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44840.12e-30ethylene-responsive element binding factor 13
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]