PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400062422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 560aa    MW: 63449.8 Da    PI: 6.3435
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400062422genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.52e-25191244155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r  W+ eLH++Fv+av+ L G +kA+Pk+ilelm+v+gL +ehv+SHLQk+Rl
  PGSC0003DMP400062422 191 KARTIWSAELHRKFVDAVNFL-GMDKAVPKKILELMNVPGLKREHVASHLQKHRL 244
                           6899*****************.********************************7 PP

2Response_reg83.94.7e-28181261109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           +l+vdD+ + +++l+q+l+k +y ev+++   e+al ll+e++  ++l+++D+ mp+mdG+ell+ i+ e  +lp+++++a ++ + + 
  PGSC0003DMP400062422  18 LLVVDDDTFYLNNLEQMLKKCQY-EVTTCNREEAALSLLRENKnyFHLVIIDVHMPDMDGFELLQYIALEM-DLPVVMMSADDSRSVVM 104
                           599********************.***************998889**********************9866.9**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           ++l  Ga+ +l+Kp+++e l +
  PGSC0003DMP400062422 105 KCLIHGAHYCLTKPVSMESLQN 126
                           ****************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.13E-3315134IPR011006CheY-like superfamily
SMARTSM004486.7E-2716128IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23005.5E-3816159No hitNo description
PROSITE profilePS5011040.42217132IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.0E-2419126IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.82E-2719131No hitNo description
SuperFamilySSF466895.2E-18188248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-26190248IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-21191244IPR006447Myb domain, plants
PfamPF002494.1E-6196243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSTSGACLNS GEFPTFRLLV VDDDTFYLNN LEQMLKKCQY EVTTCNREEA ALSLLRENKN  60
YFHLVIIDVH MPDMDGFELL QYIALEMDLP VVMMSADDSR SVVMKCLIHG AHYCLTKPVS  120
MESLQNIWQH IVRQNKDEWK CKILNQSGNV EQPKEVEYSC VTNEGGLKSS WKRKAEEYET  180
EERSDTTTLK KARTIWSAEL HRKFVDAVNF LGMDKAVPKK ILELMNVPGL KREHVASHLQ  240
KHRLLLRKYQ SEPNNAIMGH SEPTIGTMSN RFQALAPISQ FPAQNLATWG RPATNSPMFV  300
PLADQRDHFS YENPMLRYQG QQQMNDRTKQ VNLLYGIPTV VEQNPSYLGM NMPVGRISQP  360
QLQAHNMLRE SNKFLSQNGL VHNARDRMYN QVPQASSSAI DCSLNQNISL TGSSFPMSGN  420
SAMSTTKEDV NSDDIFNELY QHNVGSIFDT SYHSSIHHGI LSMEQIGQNV NSNSPIAEAV  480
LCSGQEIGHV NPMPRPHVNA ERYPSSSYQS TTFPEPFDQE DLMSAFLEQV GLNLLSLHRC  540
NTSSYVISEY FSPRTLIFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17187248162ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400062422
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349953.10.0PREDICTED: two-component response regulator ARR2
TrEMBLM1DL330.0M1DL33_SOLTU; Two-component response regulator
STRINGPGSC0003DMT4000907470.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14508910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-104response regulator 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]