PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400062002
Common NameLOC102580381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 285aa    MW: 32954.4 Da    PI: 8.033
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400062002genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.2e-51211472128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                            pGfrFhPtdeelv +yL++kve+++l   e ik++diyk+ePwdLpk+ + +ekewyfF+kr +ky+++ r+nr+t  g+Wkatg dk
  PGSC0003DMP400062002  21 LPGFRFHPTDEELVGFYLRRKVEKRPLINIELIKQIDIYKYEPWDLPKSSNMGEKEWYFFCKRGRKYRNSVRPNRVTGCGFWKATGIDK 109
                           59************************655599***************9888999*********************************** PP

                   NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +++++++e +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  PGSC0003DMP400062002 110 PIYNSTHECIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 147
                           ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5320178IPR003441NAC domain
PROSITE profilePS5100552.63520178IPR003441NAC domain
PfamPF023655.5E-2622147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MEVKSKMKYY TREEDEDEMA LPGFRFHPTD EELVGFYLRR KVEKRPLINI ELIKQIDIYK  60
YEPWDLPKSS NMGEKEWYFF CKRGRKYRNS VRPNRVTGCG FWKATGIDKP IYNSTHECIG  120
LKKSLVYYRG SAGKGTKTDW MMHEFRLPAE NDKSTKHIEA KTIAQEAEVW TLCRIIKRNK  180
CTVAAEWRIA AAAAKRNPVV DSETCSADSS DYIISFGTAP TDIVHQDMMT SSTNNSNNQQ  240
LLRSSSSILC TTQQPSSDMN FELLLKNNVD YWDELTSILD LDRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-482217919166NO APICAL MERISTEM PROTEIN
1ut4_B5e-482217919166NO APICAL MERISTEM PROTEIN
1ut7_A5e-482217919166NO APICAL MERISTEM PROTEIN
1ut7_B5e-482217919166NO APICAL MERISTEM PROTEIN
3swm_A6e-482217922169NAC domain-containing protein 19
3swm_B6e-482217922169NAC domain-containing protein 19
3swm_C6e-482217922169NAC domain-containing protein 19
3swm_D6e-482217922169NAC domain-containing protein 19
3swp_A6e-482217922169NAC domain-containing protein 19
3swp_B6e-482217922169NAC domain-containing protein 19
3swp_C6e-482217922169NAC domain-containing protein 19
3swp_D6e-482217922169NAC domain-containing protein 19
4dul_A5e-482217919166NAC domain-containing protein 19
4dul_B5e-482217919166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269|PubMed:22345491}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400062002
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269|PubMed:22345491}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015163599.10.0PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK551e-88NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM1DK550.0M1DK55_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000903270.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.12e-88NAC domain containing protein 42
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  3. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  4. Shahnejat-Bushehri S, et al.
    Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato.
    Front Plant Sci, 2017. 8: p. 214
    [PMID:28326087]
  5. Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC
    Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways.
    Plant J., 2017. 92(6): p. 1106-1120
    [PMID:29032592]
  6. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]