PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400058145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 177aa    MW: 20456.8 Da    PI: 3.9748
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400058145genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM32.62.3e-10653351
                   NAM  3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51
                           G+rFhP+d+el   +L + +++k+l+ + +i+e+d+yk ePw+ ++kv
  PGSC0003DMP400058145  6 EGYRFHPRDSELF-TFLLRFIAEKDLSDNGFITECDVYKREPWKVDTKV 53
                          69**********9.899999*****999899*************98543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-8750IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MEFEEEGYRF HPRDSELFTF LLRFIAEKDL SDNGFITECD VYKREPWKVD TKVISGVNSV  60
VPRLDHEYKA VTPINIVEPM VQIQEASSGE EIIKEQFEND DPEITCMWNE DYGMNNHPIN  120
VVENPVMEVD DVEVQIQEAV GEESGVLEFE NMLYSRCFDD PHKCRDLVPE CSRPDS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400058145
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754457e-95HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025887134.15e-23NAC domain containing protein 52-like
TrEMBLM1DBU31e-126M1DBU3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000864701e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1427357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.13e-06NAC domain containing protein 86
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]