PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400057992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 514aa    MW: 57574.3 Da    PI: 4.5955
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400057992genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.82.8e-19197250155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r+ Wt +LH++F +av++L    +  P+ ile+m+v+gLt+++v+SHLQk R 
  PGSC0003DMP400057992 197 KTRIIWTADLHDKFQQAVNKL-NDGRCFPSDILEAMNVPGLTRYQVASHLQKCRN 250
                           689******************.899***************************995 PP

2Response_reg25.28.4e-1071061101
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl++dD++++ + +  +le+++y +v+++d +++ + +l + +  +Dl+++ ++  g+  ++ll +  + +  +  + + ++ +   a+
  PGSC0003DMP400057992   7 VLLIDDDKKFVSEMIYLLESHEY-KVRTVDMASQGMSMLSKGKekIDLMIINMNSAGLLSFQLLDQAVALD--IVSVCICDEYDVRSAK 92 
                           89*********************.***************776667*******9887777777777666655..5555555677789999 PP

                           HHHHTTESEEEESS CS
          Response_reg  88 ealkaGakdflsKp 101
                           +a++ Ga  +  K+
  PGSC0003DMP400057992  93 KAFESGAYFYMQKQ 106
                           99999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.85E-95124IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.7E-105127No hitNo description
PROSITE profilePS5011016.0836120IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.5E-57107IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.92E-58105No hitNo description
SuperFamilySSF466892.87E-15195250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-20196251IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17197251IPR006447Myb domain, plants
PfamPF002491.3E-5202248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MIDEVSVLLI DDDKKFVSEM IYLLESHEYK VRTVDMASQG MSMLSKGKEK IDLMIINMNS  60
AGLLSFQLLD QAVALDIVSV CICDEYDVRS AKKAFESGAY FYMQKQLYQG FVKYMWQLVL  120
QKNIQEGKTI DVIDIVGDNV EENNVPINID EQGNDIHETT NDVVSNEKSK LRKKKGRKLT  180
EEEKSQSSAT KVIIRRKTRI IWTADLHDKF QQAVNKLNDG RCFPSDILEA MNVPGLTRYQ  240
VASHLQKCRN NTWKAPRKRK SSCRQLGISS SLGIFETTTS HVKMNVTNLQ QQETQRSPAT  300
PFLPDNNNIF ARGAESSTLQ EVYVDPQYLN PLLSNNVAEE GPLWGSNIGL EFNNGIHHAQ  360
NDYALDVATA PADTNISNAT IDGLGVANND FQQHIGELQG SNIGSADYTP GLEFNINGIH  420
HTQNDYALDT NISNATIDGL GVQQQNMAQH IVTTSHVSDT QGSEMMDCDA YFDFDKLDFF  480
YQNNELPSFD LPNEHDSLFD QVYSDDMVST ASI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253259KAPRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400057992
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015170872.10.0PREDICTED: two-component response regulator ORR24-like
TrEMBLM1DBH00.0M1DBH0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000863170.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.13e-19response regulator 11
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]