PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400057156
Common NameLOC107060895
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 372aa    MW: 42759 Da    PI: 6.5243
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400057156genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like35.13e-11238288355
               G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                            l+Wt+eL ++  e+v++LG  +kA Pk++le m v++Lt e +   L kYR+
  PGSC0003DMP400057156 238 NLKWTTELEKKLDEVVRKLG--DKAGPKNVLERMCVQDLTKECLTYRLKKYRS 288
                           589****************4..89****************************7 PP

2Response_reg36.32.9e-13201191100
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           +l+vd +++ +++++ +le++ + +v++ ++++ al +l+e+   +Dl+++D +m +md le++k+ +  + + pii+++ + + e+++
  PGSC0003DMP400057156  20 ILLVDPDKSSLSNIAAILEEHSF-KVTAIEQATIALSILREHIdqFDLVMVDANMLEMDYLEFIKSTQLIK-DKPIILMSPEVTIEMIK 106
                           89*********************.***************999778********************987777.99*************** PP

                           HHHHTTESEEEES CS
          Response_reg  88 ealkaGakdflsK 100
                           ea   G+  ++ K
  PGSC0003DMP400057156 107 EAPTQGICYIFKK 119
                           *999988766555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.98E-1617134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.7E-1717150No hitNo description
SMARTSM004480.002818129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011021.1819134IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.8E-920120IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.98E-921118No hitNo description
Gene3DG3DSA:1.10.10.605.5E-11234292IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-8238289IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDCEIICNVD VPSAYVGLRI LLVDPDKSSL SNIAAILEEH SFKVTAIEQA TIALSILREH  60
IDQFDLVMVD ANMLEMDYLE FIKSTQLIKD KPIILMSPEV TIEMIKEAPT QGICYIFKKS  120
LISSLKLKDV WKYVKWHNNK ANENSQHYKA NQVYVMDNTS CPEKMQNKKG KSITNCSETY  180
QDQAVDSLIE KDEAKRFKRM RNTIEEAQVK RSAPLEKEED YSLLSKISTK RPEKKRRNLK  240
WTTELEKKLD EVVRKLGDKA GPKNVLERMC VQDLTKECLT YRLKKYRSQK RQAPDVQPVT  300
STNFNEEHHS KAFNSSTLSV NVNELFQGAY IPQPLEVPSV ALPSSSDYSL NECDDWINEF  360
LELDDFKLKL S*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400057156
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755231e-144HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015164912.10.0PREDICTED: two-component response regulator ORR22-like
TrEMBLM1D9L20.0M1D9L2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000854810.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4899714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.21e-17response regulator 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]