PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400056273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 295aa    MW: 32923 Da    PI: 6.7052
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400056273genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY68.21.2e-21129186259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dg +WrKYGq+ v g ++pr+YYrC+   C ++k + r +++p ++e+tY g+Hn++
  PGSC0003DMP400056273 129 EDGLSWRKYGQRLVLGEKYPRKYYRCAPCCCGATKVIRRIDTEPLTFEVTYGGSHNCD 186
                           7*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.6E-21120187IPR003657WRKY domain
SuperFamilySSF1182907.06E-21126187IPR003657WRKY domain
SMARTSM007743.9E-19128187IPR003657WRKY domain
PfamPF031062.2E-19129186IPR003657WRKY domain
PROSITE profilePS5081118.728129188IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGENNCWERE VLITELTKGK ELMLQLQKHF DPMKQDVCQY LAAEILSSYD KAMSLLNGTA  60
LSGMMMSKGK EIIHPAPSSS SASQLESPHL LADSSTKSCD RPSKSRKRKT LARRTEYVEA  120
RPGEKVPPED GLSWRKYGQR LVLGEKYPRK YYRCAPCCCG ATKVIRRIDT EPLTFEVTYG  180
GSHNCDQENN NQNEQLLLAV QTQVGGTAGE LSDFYIREMV STPNNSSSTG VVFSNSNSVF  240
NMNNSDFIPT PTSSPHPLDN NSLTDFLFFH ESSANDFNSP NHILTKLSFD HYLI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104109SRKRKT
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400056273
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-131HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345568.10.0PREDICTED: probable WRKY transcription factor 41
TrEMBLM1D7L80.0M1D7L8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000842270.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120611123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11070.17e-25WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]