PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054970
Common NameLOC102585134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family VOZ
Protein Properties Length: 468aa    MW: 51949.3 Da    PI: 5.702
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054970genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ406.45.5e-1251874061217
                   VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaata 86 
                           pppsaflgpkcalwdc+rpa gs+w+q   dycs +ha+la neg +g  pv+rp g++lkd+llf+alsak++gk+vg+pec+gaata
  PGSC0003DMP400054970 187 PPPSAFLGPKCALWDCPRPAMGSDWCQkshDYCSDYHAALAPNEGYLGRPPVVRPMGVGLKDSLLFQALSAKAHGKDVGVPECKGAATA 275
                           89***********************976668********************************************************** PP

                   VOZ  87 kspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyein 175
                           kspwna+elfdl+++ getirewlffdkprrafesgnrkqrslpdy+grgwhesrkqv++++gglkrsyymdpqp++++ewhlyeyein
  PGSC0003DMP400054970 276 KSPWNAPELFDLKVVVGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVINDYGGLKRSYYMDPQPMKNLEWHLYEYEIN 364
                           ***************************************************************************************** PP

                   VOZ 176 eldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                           ++da alyrlelklvd+kks+kgkv+++s+adlqk++grl+a
  PGSC0003DMP400054970 365 KYDAWALYRLELKLVDGKKSPKGKVTNESVADLQKQMGRLSA 406
                           ****************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MGKSSKNGAL FKDKAKNRVD DLQGMFMNLQ SARKESRTYD AGVLEEQVHQ MLREWKAELN  60
EPSPASSLQG GSRISSDLYR LLHGEEEDDA TSALAAPKPE PDAQKQDVTG FQEGFNATPV  120
LQDQGYQLVD ECKNTPLVVN NAGINNLGVA TQLDYHSFDL HQDFDQFGFD ALNLCLEDDL  180
SPIQISPPPS AFLGPKCALW DCPRPAMGSD WCQKSHDYCS DYHAALAPNE GYLGRPPVVR  240
PMGVGLKDSL LFQALSAKAH GKDVGVPECK GAATAKSPWN APELFDLKVV VGETIREWLF  300
FDKPRRAFES GNRKQRSLPD YNGRGWHESR KQVINDYGGL KRSYYMDPQP MKNLEWHLYE  360
YEINKYDAWA LYRLELKLVD GKKSPKGKVT NESVADLQKQ MGRLSAEFPL ENKRSAKGRG  420
KANSKDVGTN GPPAPNQTVP AIEGFDYVAG ALFPDYLVDN TGGYYIT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054970
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364322.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM1D4F40.0M1D4F4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000812410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]