PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 388aa    MW: 43841.3 Da    PI: 7.6004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054481genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.31.2e-5251321128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           + pGfrFhPtdeelv +yL++kv++k++++ e ik++diyk++PwdLpk ++ +ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d
  PGSC0003DMP400054481   5 MLPGFRFHPTDEELVGFYLRRKVQQKPISI-ELIKQLDIYKYDPWDLPKLAAVGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTD 92 
                           579***************************.89***************8778899********************************** PP

                   NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ++++s+ +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  PGSC0003DMP400054481  93 RPIYSSeGSKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 132
                           *****956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-574163IPR003441NAC domain
PROSITE profilePS5100557.3165163IPR003441NAC domain
PfamPF023651.2E-257132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MDEVMLPGFR FHPTDEELVG FYLRRKVQQK PISIELIKQL DIYKYDPWDL PKLAAVGEKE  60
WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG SKCIGLKKSL VFYKGRAAKG  120
IKTDWMMHEF RLPSITDSTA PKRFLDKHIP PNDSWAICRI FKKANSNAHR ALSHSWVSPP  180
QVLPQNNTTS HDFLTSSHFT NNSNEMSSFI HKTSTSPIQF NDLLQNSSNN NMSSSFTTLD  240
LPLYKTLNSM SNHNNDPITS YTFSSSCVDN MNNIDASSLL LNMSSSIFGD YSIALPENME  300
GGGVHDDTTT TTLKEANNVI INNMEHMEEL QWGNVVRSNN IGVIPLMNNF PLNMAADAWK  360
TNLLWDSSSP CPSSEMSTSY STNKCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-54716619168NO APICAL MERISTEM PROTEIN
1ut4_B2e-54716619168NO APICAL MERISTEM PROTEIN
1ut7_A2e-54716619168NO APICAL MERISTEM PROTEIN
1ut7_B2e-54716619168NO APICAL MERISTEM PROTEIN
4dul_A2e-54716619168NAC domain-containing protein 19
4dul_B2e-54716619168NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054481
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1465060.0AC146506.1 Solanum demissum chromosome 5 clone PGEC989P08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006366116.10.0PREDICTED: putative NAC domain-containing protein 94
TrEMBLM1D3A90.0M1D3A9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000803070.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22022262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-106NAC family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]