PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054452
Common NameLOC102578174
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HB-other
Protein Properties Length: 512aa    MW: 57620.7 Da    PI: 7.3108
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054452genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox542.9e-172276357
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                          kR   t+ q+e+Le+l+e+++yp+ e +++LA++ gLte+q++ WF+ rR k+k+
  PGSC0003DMP400054452 22 KRIIKTRAQIEALEKLYEEHKYPTDELKADLAESSGLTEKQISGWFCHRRLKDKR 76
                          89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-20376IPR009057Homeodomain-like
SuperFamilySSF466891.11E-151377IPR009057Homeodomain-like
PROSITE profilePS5007115.921777IPR001356Homeobox domain
SMARTSM003896.1E-171981IPR001356Homeobox domain
CDDcd000868.36E-152276No hitNo description
PfamPF000467.9E-152276IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MMEDLSEVHS KDDKGQPEKN HKRIIKTRAQ IEALEKLYEE HKYPTDELKA DLAESSGLTE  60
KQISGWFCHR RLKDKRLSNG EIYINGRQDR SSGVIQDHGS GFRQDSCGST KQADDKKFDH  120
REVESRRLTG AEFSTADVAY EAGTHFRGKS ICMDDDSSRS SSSLRNECFS QNAEPYDIAT  180
SRYISQNLPT NFKGVKPKNG PSGYLKVKGQ VENAAITAVK RQLGRHYRLD GPPLGIEFDP  240
LPPGAFESSA PNPVNEPVPA CSPDMSNVYR RSNGFGPNSK SNSHDSDLDG LSFKRKSNST  300
HPEYRFNPKP KLKSSEQNEY PEWNPSLDMY EGSARKMTVD SRDSCKFMAK HGRGEIRTST  360
GSGNGLRNPY VGKVDGEQVK PWFSNRSEVS LAALEKEHLD RKPSDFKGSE YHNFRERELH  420
KIVEKDHISG KRPVVDENSN LVRVKVQVPR HNEITVVQRA PNEVPDHQEY LRRASMIGMP  480
LQTNHQISTA AEKPPSFSED EETEDTSSFE G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362312.10.0PREDICTED: uncharacterized protein LOC102578174
TrEMBLM1D3840.0M1D384_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000802670.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-67HB-other family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]