PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 599aa    MW: 67215.9 Da    PI: 4.4778
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054267genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.4e-51321582128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                           ppGfrFhPtdeelv +yLk+k+ ++++ l ++i+e+d+yk+eP+dLp  +k+k+++++w+fFs+rd+ky++g r+nra k+gyWkatgk
  PGSC0003DMP400054267  32 PPGFRFHPTDEELVLYYLKRKICRRRILL-DAIAETDVYKWEPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARSNRASKHGYWKATGK 119
                           9*************************999.99**************96559999*********************************** PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           d+ +++ ++++vg+kktLvfykgrap ge+tdWvmhey++
  PGSC0003DMP400054267 120 DRIITC-NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 158
                           ******.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5925181IPR003441NAC domain
PROSITE profilePS5100555.71431181IPR003441NAC domain
PfamPF023655.0E-2732157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MKLLMDSSAP SSSSPCKEMK VSECFGENSV FPPGFRFHPT DEELVLYYLK RKICRRRILL  60
DAIAETDVYK WEPEDLPDLS KLKTGDRQWF FFSPRDRKYP NGARSNRASK HGYWKATGKD  120
RIITCNSRAV GVKKTLVFYK GRAPVGERTD WVMHEYTMDE EELKRCQNAQ DYYALYKVFK  180
KSGPGPKNGE QYGAPFREED WVDDECLNAK VSVQPEIPRH QESSAKNINV VPAPDDAIEE  240
LLKRPFTVDN NFALEQFVQE EDTESTLLNQ SSREVDLYNH CAVAGPSCQQ YDARASFDLT  300
ESGTSPLHLY EAPEVSSAPV NPVNPPYVVE EDFLEDFLEM DDLLVAEPNV QNFDHETPNG  360
QVFDKPAGNL ETLQFDDFDG LSEFDLYHDA PSRLDNVGTP TVGQIAEPYM NNFVNGITYP  420
DSTTYMSTFQ NDMMNNQQMC LNHENQINNQ FWMHDERFGS FNPIEEDQSV VDQASSGVVN  480
DNNMANYPMG ANQNLAKKDD GTQSWFSSNL WAFVDSIPTT PASAAESALV VNRAFERMSS  540
FSRMKLNVGN MNVAAGNTSA TSSSSGKAKY GLCCISLLGV LCAFLWVLIG TSAKIVGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-483115815140Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054267
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375230.0KF437523.1 Solanum tuberosum putative membrane bound NAC transcription factor 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074110.10.0NAC domain-containing protein 17-like
TrEMBLM1D2U00.0M1D2U0_SOLTU; Uncharacterized protein
STRINGSolyc04g072220.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.15e-93NAC domain containing protein 17
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]