PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 902aa    MW: 101750 Da    PI: 4.5903
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054265genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.4e-51321582128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                           ppGfrFhPtdeelv +yLk+k+ ++++ l ++i+e+d+yk+eP+dLp  +k+k+++++w+fFs+rd+ky++g r+nra k+gyWkatgk
  PGSC0003DMP400054265  32 PPGFRFHPTDEELVLYYLKRKICRRRILL-DAIAETDVYKWEPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARSNRASKHGYWKATGK 119
                           9*************************999.99**************96559999*********************************** PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           d+ +++ ++++vg+kktLvfykgrap ge+tdWvmhey++
  PGSC0003DMP400054265 120 DRIITC-NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 158
                           ******.999****************************87 PP

2NAM100.62.1e-3137746144128
                   NAM  44 PwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           P+ +  +k+k+++++w+fFs+rd+ky++g r+nra k+gyWkatgkd+ +++ ++++vg+kktLvfykgrap ge+tdWvmhey++
  PGSC0003DMP400054265 377 PNLFYlSKLKTGDRQWFFFSPRDRKYPNGARSNRASKHGYWKATGKDRIITC-NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 461
                           433333488899****************************************.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5925181IPR003441NAC domain
PROSITE profilePS5100555.71431181IPR003441NAC domain
PfamPF023659.5E-2732157IPR003441NAC domain
PROSITE profilePS5100534.9331484IPR003441NAC domain
PfamPF023658.0E-15377460IPR003441NAC domain
SuperFamilySSF1019411.83E-36379484IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 902 aa     Download sequence    Send to blast
MKLLMDSSAP SSSSPCKEMK VSECFGENSV FPPGFRFHPT DEELVLYYLK RKICRRRILL  60
DAIAETDVYK WEPEDLPDLS KLKTGDRQWF FFSPRDRKYP NGARSNRASK HGYWKATGKD  120
RIITCNSRAV GVKKTLVFYK GRAPVGERTD WVMHEYTMDE EELKRCQNAQ DYYALYKVFK  180
KSGPGPKNGE QYGAPFREED WVDDECLNAK VSVQPEIPRH QESSAKNINV VPAPDDAIEE  240
LLKRPFTVDN NFALEQFVQE EDTESTLLNQ SSREVDLYNH CAVAGPSCQQ YDARASFDLT  300
ESGTSPLHLY EAPEVSSAPV NPVNPPYVVE EDFLEDFLEM DDLLVAIQDL ESVGAKWDSN  360
PQPQPSKVAL LPWHHKPNLF YLSKLKTGDR QWFFFSPRDR KYPNGARSNR ASKHGYWKAT  420
GKDRIITCNS RAVGVKKTLV FYKGRAPVGE RTDWVMHEYT MDEEELKRCQ NAQDYYALYK  480
VFKKSGPGPK NGEQYGAPFR EEDWVDDECL NAKVSVQPEI PRHQESSAKN INVVPAPDDA  540
IEELLKRPFT VDNNFALEQF VQEEDTESTL LNQSSREVDL YNHCAVAGPS CQQYDARASF  600
DLTESGTSPL HLYEAPEVSS APVNPVNPPY VVEEDFLEDF LEMDDLLVAE PNVQNFDHET  660
PNGQVFDKPA GNLETLQFDD FDGLSEFDLY HDAPSRLDNV GTPTVGQIAE PYMNNFVNGI  720
TYPDSTTYMS TFQNDMMNNQ QMCLNHENQI NNQFWMHDER FGSFNPIEED QSVVDQASSG  780
VVNDNNMANY PMGANQNLAK KDDGTQSWFS SNLWAFVDSI PTTPASAAES ALVVNRAFER  840
MSSFSRMKLN VGNMNVAAGN TSATSSSSGK AKYGLCCISL LGVLCAFLWV LIGTSAKIVG  900
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-463146115140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054265
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375230.0KF437523.1 Solanum tuberosum putative membrane bound NAC transcription factor 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015169691.10.0PREDICTED: NAC domain-containing protein 17-like
SwissprotQ9XIC51e-109NAC17_ARATH; NAC domain-containing protein 17
TrEMBLM1D2T80.0M1D2T8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000799950.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.17e-90NAC domain containing protein 17
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Van Aken O, et al.
    Mitochondrial and Chloroplast Stress Responses Are Modulated in Distinct Touch and Chemical Inhibition Phases.
    Plant Physiol., 2016. 171(3): p. 2150-65
    [PMID:27208304]
  4. Van Aken O,Ford E,Lister R,Huang S,Millar AH
    Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance.
    Plant J., 2016. 88(4): p. 542-558
    [PMID:27425258]
  5. Hu Z, et al.
    Mitochondrial Defects Confer Tolerance against Cellulose Deficiency.
    Plant Cell, 2016. 28(9): p. 2276-2290
    [PMID:27543091]
  6. Chi YH, et al.
    The membrane-tethered NAC transcription factor, AtNTL7, contributes to ER-stress resistance in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2017. 488(4): p. 641-647
    [PMID:28088515]
  7. Van Aken O,Pogson BJ
    Convergence of mitochondrial and chloroplastic ANAC017/PAP-dependent retrograde signalling pathways and suppression of programmed cell death.
    Cell Death Differ., 2017. 24(6): p. 955-960
    [PMID:28498364]
  8. Cheng P, et al.
    The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 182
    [PMID:29497438]