PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054263
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 182aa    MW: 21137.9 Da    PI: 8.0281
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054263genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM73.55.1e-2351372128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykv.ePwdLpk....kvkaeek..ewyfFskrdkkyatgkrknr.atksg 81 
                             GfrF+Ptd e v  +L + ++gk ++ + +  ++vd y+  ePwd+ +    +++ +++  ++ fF+++ kk++ ++r +r + ++g
  PGSC0003DMP400054263   5 EEGFRFSPTDAEAV-TFLLRFIAGKFMDDSGFiTTHVDTYSEqEPWDIYShgvpCCNDDNDctQYRFFITTLKKKS-ESRYSRnVGNKG 91 
                           68************.89999*****9999888345668876449****7346663333222324456666666655.6677775888** PP

                   NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            Wk++ k+k+v +k+g ++g kk++ +  ++  k e  +W+m+ey l
  PGSC0003DMP400054263  92 SWKQQDKSKPVRKKGGPVIGYKKSMCYK-NKGYKQEDGHWLMKEYDL 137
                           **************************97.66667789********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-213159IPR003441NAC domain
PROSITE profilePS5100524.0444160IPR003441NAC domain
PfamPF023651.2E-146137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MENLEEGFRF SPTDAEAVTF LLRFIAGKFM DDSGFITTHV DTYSEQEPWD IYSHGVPCCN  60
DDNDCTQYRF FITTLKKKSE SRYSRNVGNK GSWKQQDKSK PVRKKGGPVI GYKKSMCYKN  120
KGYKQEDGHW LMKEYDLSTY ILDKFDKDCR DIVLCAIKKR TRTKATMMLM NEECTNSEDQ  180
T*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054263
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-173HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015169693.11e-119PREDICTED: NAC domain-containing protein 78-like
TrEMBLM1D2T61e-134M1D2T6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000799921e-135(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22191254
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.19e-13NAC domain containing protein 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]