PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054257
Common NameLOC102604232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 232aa    MW: 26679.1 Da    PI: 7.0672
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054257genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY84.41.1e-26150208159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYG+K+vk + + r+YY+C+s +C+vkkkver+ +d +++ +tYeg+Hnhe
  PGSC0003DMP400054257 150 LDDGYKWRKYGKKKVKTNIYLRNYYKCSSGDCKVKKKVERDGNDSRYLMTTYEGKHNHE 208
                           59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-28136210IPR003657WRKY domain
SuperFamilySSF1182901.83E-24143210IPR003657WRKY domain
PROSITE profilePS5081127.542145210IPR003657WRKY domain
SMARTSM007741.5E-28150209IPR003657WRKY domain
PfamPF031062.0E-20151208IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MFASSTFQET TNVISHQHYQ TINPNSFAFH DPIINMNQDY GHNNSNNNKY QDYDTSFLDL  60
LVDGDQEYYS NYSNNSYNNA SIFSENPFMK QEISTSTYST SGNSSSASSF DATPTHVHMN  120
HENSSMGIEK EKKGEKHAIA FRTKTQLETL DDGYKWRKYG KKKVKTNIYL RNYYKCSSGD  180
CKVKKKVERD GNDSRYLMTT YEGKHNHESP FIIYCNEKPA NNFLNESSSS Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-23134210177Probable WRKY transcription factor 4
2ayd_A5e-23139210374WRKY transcription factor 1
2lex_A5e-23134210177Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054257
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-130HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006359017.11e-172PREDICTED: probable WRKY transcription factor 51
TrEMBLM1D2T01e-171M1D2T0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000799801e-171(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA134941217
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.13e-23WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]