PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054120
Common NameLOC107063498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 401aa    MW: 45045.4 Da    PI: 5.076
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054120genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-52301571128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           l+pGfrFhPtdeelv +yL++k+ gk++++ e+++e+d+yk+ePwdL+  +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatg
  PGSC0003DMP400054120  30 LAPGFRFHPTDEELVRYYLRRKACGKPFRI-EAVSEIDVYKSEPWDLRdySSLKTRDLEWYFFSPVDRKYGNGSRLNRATGQGYWKATG 117
                           579***************************.89**************84347777888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd++v + k+e++g+kktLvf++grap+g++t+Wvmheyrl
  PGSC0003DMP400054120 118 KDRPVRH-KSETIGMKKTLVFHNGRAPDGKRTNWVMHEYRL 157
                           *******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6321180IPR003441NAC domain
PROSITE profilePS5100558.37830180IPR003441NAC domain
PfamPF023653.1E-2832157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MEQEGALVLA PAPVGPVTPR RAVAAPATSL APGFRFHPTD EELVRYYLRR KACGKPFRIE  60
AVSEIDVYKS EPWDLRDYSS LKTRDLEWYF FSPVDRKYGN GSRLNRATGQ GYWKATGKDR  120
PVRHKSETIG MKKTLVFHNG RAPDGKRTNW VMHEYRLADE ELEAAGVVQD AFVLCRIFQK  180
SGLGPPNGDR YAPFIEEEWN DDTTLMVPGG ETEDDVANGD EARVEGNEFD QDVHGKAPCQ  240
SENLLEPRPL SFVCKRERSE DLELLSLAQS KRSKHDDPSS SHANGSEDST TSQQDPPTKT  300
MTTNYSPTLL TFPLLDPLEP KEAQPSNSLN FDSSNLEKSV PPGYLKFISN LENEILNVSM  360
ERETAKIEVM RAQAMINILQ SRLDLLNKEN EDLRRLVRGG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-512918016165NO APICAL MERISTEM PROTEIN
1ut4_B7e-512918016165NO APICAL MERISTEM PROTEIN
1ut7_A7e-512918016165NO APICAL MERISTEM PROTEIN
1ut7_B7e-512918016165NO APICAL MERISTEM PROTEIN
3swm_A7e-512918019168NAC domain-containing protein 19
3swm_B7e-512918019168NAC domain-containing protein 19
3swm_C7e-512918019168NAC domain-containing protein 19
3swm_D7e-512918019168NAC domain-containing protein 19
3swp_A7e-512918019168NAC domain-containing protein 19
3swp_B7e-512918019168NAC domain-containing protein 19
3swp_C7e-512918019168NAC domain-containing protein 19
3swp_D7e-512918019168NAC domain-containing protein 19
4dul_A7e-512918016165NAC domain-containing protein 19
4dul_B7e-512918016165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054120
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ5132890.0JQ513289.1 Solanum lycopersicum NAM-like protein (NLP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015170903.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A0V0I6Z30.0A0A0V0I6Z3_SOLCH; Putative NAC domain-containing protein 78-like
TrEMBLM1D2G10.0M1D2G1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.27e-96NAC domain containing protein 50
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]