PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054118
Common NameLOC102582253
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 544aa    MW: 61093.9 Da    PI: 4.4363
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054118genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.9e-54101381128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           l+pGfrFhPtdeelv +yL++k+ g++++  + i+e+diykvePwdLp  +++k+++ ewyfFs  dkky +g r+nrat++gyWk+tg
  PGSC0003DMP400054118  10 LAPGFRFHPTDEELVRYYLRRKIYGRTFKS-DLISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTG 97 
                           579*************************99.99***************6347788888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd++v+++k+++vg+kktLv+++grapkg++t+Wvmheyrl
  PGSC0003DMP400054118  98 KDRAVHRNKSQVVGMKKTLVYHNGRAPKGQRTNWVMHEYRL 138
                           ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-629161IPR003441NAC domain
PROSITE profilePS5100559.06310161IPR003441NAC domain
PfamPF023658.0E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MESRGSSKLL APGFRFHPTD EELVRYYLRR KIYGRTFKSD LISEIDIYKV EPWDLPGMSR  60
LKTRDLEWYF FSVLDKKYGN GARTNRATEK GYWKTTGKDR AVHRNKSQVV GMKKTLVYHN  120
GRAPKGQRTN WVMHEYRLID EALDNAGIPQ DAFVLCRVFQ KSGAGPKNGE QYGAPFIEEE  180
WEDDELQVLP KDETAEDFVF GDDIYLDANE LDQILGTDKA VAGASLPLDY SFGENGSTEE  240
TNNSSDAQNW LQQPDELKPI DLAVQQNFNA EQVNHEYIGE SSKNMNSEDG DYLLNEPIVN  300
GTDDLQFNDE AFLEANDLSN PVQVDSSGFD MFEEYLTYFD ANDDFQNMSF DPSVFFGNDD  360
QISDQALLPE KDVGEVTQQP IAPNEGFGED KNGFAASSKL VPTKFGSDYQ LPFMKQASQM  420
LGNIHAPPAF ASEFPTKDAI LRLNSLSRSA SPVQVTADLI RIRDMSAGGN GTRWPLGKHV  480
YYNIILSLGL SRSSSDDSSM DSFHSIHPGK TTSTISRGWF CYLFFSFLML LMSLRIGTTI  540
CAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-481016717171NO APICAL MERISTEM PROTEIN
1ut4_B9e-481016717171NO APICAL MERISTEM PROTEIN
1ut7_A9e-481016717171NO APICAL MERISTEM PROTEIN
1ut7_B9e-481016717171NO APICAL MERISTEM PROTEIN
3swm_A1e-471016720174NAC domain-containing protein 19
3swm_B1e-471016720174NAC domain-containing protein 19
3swm_C1e-471016720174NAC domain-containing protein 19
3swm_D1e-471016720174NAC domain-containing protein 19
3swp_A1e-471016720174NAC domain-containing protein 19
3swp_B1e-471016720174NAC domain-containing protein 19
3swp_C1e-471016720174NAC domain-containing protein 19
3swp_D1e-471016720174NAC domain-containing protein 19
4dul_A9e-481016717171NAC domain-containing protein 19
4dul_B9e-481016717171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400054118
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0137470.0BT013747.1 Lycopersicon esculentum clone 132610F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361710.10.0PREDICTED: NAC domain-containing protein 53-like
TrEMBLM1D2F90.0M1D2F9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-132NAC domain containing protein 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]