PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400052761
Common NameLOC102585727
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WOX
Protein Properties Length: 237aa    MW: 26682.8 Da    PI: 8.3912
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400052761genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53e-202179457
                          -SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          R+++tkeq++ Le+l+++  r+psae++++++ +l    +++ ++V++WFqN++a++++
  PGSC0003DMP400052761 21 RWNPTKEQIDLLESLYKQgIRTPSAEQIQQITGRLrafgHIEGKNVFYWFQNHKARQRQ 79
                          9****************99**************************************97 PP

2Wus_type_Homeobox113.41.1e-362081465
     Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                           RW+Pt+eQi +Le+lyk+G+rtP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqkq
  PGSC0003DMP400052761 20 CRWNPTKEQIDLLESLYKQGIRTPSAEQIQQITGRLRAFGHIEGKNVFYWFQNHKARQRQKQ 81
                          6***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.5E-41784IPR001356Homeobox domain
SuperFamilySSF466897.27E-121984IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-82079IPR009057Homeodomain-like
CDDcd000862.85E-62181No hitNo description
PfamPF000467.0E-182179IPR001356Homeobox domain
PROSITE profilePS5007110.562580IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MSDNNMSVDM LTSGGTPVGC RWNPTKEQID LLESLYKQGI RTPSAEQIQQ ITGRLRAFGH  60
IEGKNVFYWF QNHKARQRQK QKQDKFAYYN RFLHRTSVFP PPNCPNVVCS PYYTAQNNLG  120
FYQQYPSMII PGPGGFKRRA TCNQETLNLC EQNNITNANK EFINQETLNL FPLHPTGVLQ  180
EKTTTTDSSS SSSTCVPHDH QSSITTSNSV EANCFTDLGI GASDRPNPVF NFLCRN*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400052761
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-160HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350912.11e-179PREDICTED: WUSCHEL-related homeobox 2
SwissprotQ6X7K13e-52WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLM1CZ361e-177M1CZ36_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000779471e-178(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-36WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  3. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  4. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]