PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400051536
Common NameLOC102586730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 349aa    MW: 39298.9 Da    PI: 7.8431
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400051536genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.39.8e-56111361127
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhP+deel+++yL +k++++++ ++++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkd
  PGSC0003DMP400051536  11 LPPGFRFHPSDEELITYYLMNKISDSNNFIARAIGDVDLNKSEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNSGYWKTTGKD 99 
                           79*************************999999***************99999************************************ PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                           +e++s ++elvg+kktLvfykgrap+gekt+Wvmheyr
  PGSC0003DMP400051536 100 REIFS-NSELVGMKKTLVFYKGRAPRGEKTNWVMHEYR 136
                           *****.99*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-646159IPR003441NAC domain
PROSITE profilePS5100560.82711159IPR003441NAC domain
PfamPF023654.1E-2812136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MEGEVKEELD LPPGFRFHPS DEELITYYLM NKISDSNNFI ARAIGDVDLN KSEPWDLPGK  60
AKMGEKEWYF FSLRDRKYPT GVRTNRATNS GYWKTTGKDR EIFSNSELVG MKKTLVFYKG  120
RAPRGEKTNW VMHEYRDHSK SSYRTHKQHE WVVCRVFQKS NAGGKKYPSN NNTSRIHVNP  180
YTTLDQINPN TICISSQMMM PQAHEHNANQ LAMGRPSSSS SSAYNMINHP EIQEFNRVFQ  240
GVSTSSSSNM MNLHPILQSQ MNYNLGGGNG FTISGLNLNL GGGGATTSQL VPPPPPPPQD  300
MSSSSHVMMT THDDQAGYGE NMSSGHAMNR FMVMENSAHD LDNYWANY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-54816517174NAC domain-containing protein 19
3swm_B4e-54816517174NAC domain-containing protein 19
3swm_C4e-54816517174NAC domain-containing protein 19
3swm_D4e-54816517174NAC domain-containing protein 19
3swp_A4e-54816517174NAC domain-containing protein 19
3swp_B4e-54816517174NAC domain-containing protein 19
3swp_C4e-54816517174NAC domain-containing protein 19
3swp_D4e-54816517174NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400051536
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755201e-177HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355216.10.0PREDICTED: NAC domain-containing protein 83-like
TrEMBLM1CW690.0M1CW69_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000761030.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.26e-96NAC domain containing protein 38
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]