PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400051455
Common NameLOC102580095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Trihelix
Protein Properties Length: 316aa    MW: 36271.5 Da    PI: 5.0074
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400051455genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix27.96.3e-091886270
              trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70
                          Wt +e  +L++  + ++ + +++ +  ++W++   ++ + g++rs +qCk +we++  +y k+k +e+ 
  PGSC0003DMP400051455 18 WTLHESVTLVNEMKATQIECGNTLASFQKWQSTVHNCNSLGVNRSLNQCKRRWESMLEQYNKVKPWESA 86
                          99999999999999999999999999**************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138377.5E-81785No hitNo description
PROSITE profilePS500906.4351874IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MERSGGSLRT RSQAAPDWTL HESVTLVNEM KATQIECGNT LASFQKWQST VHNCNSLGVN  60
RSLNQCKRRW ESMLEQYNKV KPWESAYWDS FDEERKRELD LPEQFDFELF NAIARYLSLE  120
GEDGGGAETD PDTDPEAQQV QGNNAFLEIG PKRQRRRTKT KRYKMEERLN PWRRILNENR  180
KYEQSKMGIK HEASIDANLE APRYDNSSLE IKRETSSPEE MTELPNLSMV SKVKAEQFNV  240
NPEEMMAATL RENAEMITAI TEGNTMDDRD CSLADLNNFD VGRVHLIRSQ GNQLIDCLGK  300
ISDTLIQLCD AIHKK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355199.10.0PREDICTED: trihelix transcription factor ASR3
TrEMBLM1CW130.0M1CW13_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000759810.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA83602124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.12e-43sequence-specific DNA binding transcription factors
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]