PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400051406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 266aa    MW: 29825.3 Da    PI: 5.6683
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400051406genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.31.1e-25209258151
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                           kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQ
  PGSC0003DMP400051406 209 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQ 258
                           79*******************.***************************** PP

2Response_reg791.6e-26251331109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdD+ + +++++q+l++ +y +v++++++  al+ll+ek+  +D++l D+ mp+mdG++ll+     e++lp+i++++ g  +++ 
  PGSC0003DMP400051406  25 VLVVDDDVVCLRIIEQMLRRCKY-SVTTCTQAMVALNLLREKRgtFDIVLSDVHMPDMDGFKLLELVGL-EMDLPVIMMSGDGRTNLVM 111
                           89*********************.***************999999*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + ++ Ga d+l Kp+  eel +
  PGSC0003DMP400051406 112 RGVQHGACDYLIKPIRDEELKN 133
                           *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-1385261IPR017053Response regulator B-type, plant
SuperFamilySSF521728.25E-3622146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.1E-4122146No hitNo description
SMARTSM004482.8E-2923135IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.29224139IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2325133IPR001789Signal transduction response regulator, receiver domain
CDDcd001566.09E-2237138No hitNo description
PROSITE profilePS5129411.075206265IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-26206258IPR009057Homeodomain-like
SuperFamilySSF466891.65E-16206259IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-22209259IPR006447Myb domain, plants
PfamPF002491.3E-6211258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSGDVATCKS EATVVTDHFP LGLRVLVVDD DVVCLRIIEQ MLRRCKYSVT TCTQAMVALN  60
LLREKRGTFD IVLSDVHMPD MDGFKLLELV GLEMDLPVIM MSGDGRTNLV MRGVQHGACD  120
YLIKPIRDEE LKNIWQHVVR KRYNSSKELE CSGSLDDNDR YKRGSDDAEC ASSVIEGADG  180
VLKPQKKKRE AKEEDDTEME NDDPSTSKKP RVVWSVELHQ QFVSAVNQLG IDKAVPKRIL  240
ELMNVPGLTR ENVASHLQVR ISMHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-19205258154ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400051406
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF4125410.0JF412541.1 Nicotiana tabacum RRB1 type-b response regulator mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355058.10.0PREDICTED: two-component response regulator ARR14 isoform X1
SwissprotQ8H7S71e-111ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLM1CVW90.0M1CVW9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000759070.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.18e-88response regulator 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]