PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400051145
Common NameLOC102578495
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family CO-like
Protein Properties Length: 358aa    MW: 39093.3 Da    PI: 5.2473
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400051145genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box186e-061143436
              zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                          + C+ ++  +++ fC+ ++ +lC  C  ++H  
  PGSC0003DMP400051145 11 KLCDSCKTTPATVFCRADSAFLCLGCDCKIHAA 43
                          68*************************999954 PP

2zf-B_box24.94.3e-085395339
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                           ++C+ +e+ +++  C+ +   lC +C   +H+       H++
  PGSC0003DMP400051145 53 VWVCEVCEQAPAIVTCKADAAALCVTCDHDIHSAnplarrHER 95
                          689*****************************65777777776 PP

3CCT70.54.1e-24294337144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  PGSC0003DMP400051145 294 REARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 337
                           9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.9E-9855IPR000315B-box-type zinc finger
PROSITE profilePS501199.954855IPR000315B-box-type zinc finger
CDDcd000211.02E-61255No hitNo description
PROSITE profilePS5011910.1965198IPR000315B-box-type zinc finger
PfamPF006433.9E-65397IPR000315B-box-type zinc finger
CDDcd000217.72E-75498No hitNo description
SMARTSM003364.1E-95698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.896294336IPR010402CCT domain
PfamPF062032.4E-18294336IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGTENWSLTA KLCDSCKTTP ATVFCRADSA FLCLGCDCKI HAANKLASRH ARVWVCEVCE  60
QAPAIVTCKA DAAALCVTCD HDIHSANPLA RRHERFPVVP FYDSAVAKSD GGGDADADAA  120
DDEKYFDSTS ENPSQPEEEA EAASWILPTP KEGTDQYKSA DYLFNDMDSY LDIDLMSCEQ  180
KPHIIHHQHG HYSSDGVVPV QNNNNNNETS THLPGPVVDG FPTYEIDFAG SKPYMYNFTS  240
QSISQSVSSS SIDVGVVPDH SAMTDVSNTF VMNSSAGTGT GTDAVPNAVS GLDREARVMR  300
YREKRKNRKF EKTIRYASRK AYAETRPRIK GRFAKRTEIE IDSLIAADAS YGVVPSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400051145
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8826840.0DQ882684.1 Solanum tuberosum CONSTANS-like protein (CO) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006342453.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-102COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLM1CVB00.0M1CVB0_SOLTU; B-box zinc finger protein 4
STRINGPGSC0003DMT4000755200.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.12e-97CONSTANS-like 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]