PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400049938
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 526aa    MW: 58745.1 Da    PI: 4.4724
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400049938genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.13.1e-4841311128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lppGfrFhPtd el+++yLk+k++gkk+++ evi+e++iyk+ PwdLp k ++k+++ ewyfF++r++kya+g r nrat+sgyWk+tg
  PGSC0003DMP400049938   4 LPPGFRFHPTDVELIMYYLKRKITGKKFHF-EVITELNIYKFSPWDLPdKcCYKSKDLEWYFFCPRERKYASGGRMNRATDSGYWKTTG 91 
                           79***************************9.99***************6545666777******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd+ v+  +++ vg  ktLvf+ g+ p+g++tdW++hey++
  PGSC0003DMP400049938  92 KDRYVTY-DEKIVGSVKTLVFHLGHPPRGQRTDWLIHEYKF 131
                           *******.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-572154IPR003441NAC domain
PROSITE profilePS5100553.3554154IPR003441NAC domain
PfamPF023653.0E-245130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MARLPPGFRF HPTDVELIMY YLKRKITGKK FHFEVITELN IYKFSPWDLP DKCCYKSKDL  60
EWYFFCPRER KYASGGRMNR ATDSGYWKTT GKDRYVTYDE KIVGSVKTLV FHLGHPPRGQ  120
RTDWLIHEYK FEDKESIDAG FAQDSYVLYK VFQKSGPGPK NGAQYGAPFK EEDWEDDKIP  180
AEPCTSDVFP APPGRPDKPS TSNATRVVDP GSTSVWPSSE LSPSPIQPSV QKLPLDEPDD  240
EELPGEPKLS NVSSINWMPS DQLKAKSSNI FSALPILPEK QSCSVDTSLA NPGPGPSNDQ  300
MCTNEMAPDE LDDEMIGLFT QFTEDTSLLS GGNETNQKLE NFHQDVNAPS AAFTDGNDIF  360
DDLGDIEVWA RVGQLEPDLT ASGGANYSLN PVILPQDAAY MELNDLDIPL NHPAETIGTG  420
QLVPGHFCTP YNSNIGMQQL CFGSNSLGIV QDFGEHRLPT LPESYTQQVN HPDMAYNFQN  480
NANHGYNAAT NFSVSSYKQP EESRLDAQNL ERGRSHFSDD NSAWW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-43416017171NO APICAL MERISTEM PROTEIN
1ut4_B2e-43416017171NO APICAL MERISTEM PROTEIN
1ut7_A2e-43416017171NO APICAL MERISTEM PROTEIN
1ut7_B2e-43416017171NO APICAL MERISTEM PROTEIN
4dul_A2e-43416017171NAC domain-containing protein 19
4dul_B2e-43416017171NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400049938
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136830.0BT013683.1 Lycopersicon esculentum clone 132505F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165759.10.0PREDICTED: NAC domain-containing protein 82-like isoform X2
TrEMBLM1CSN10.0M1CSN1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000737790.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.43e-81NAC domain containing protein 82
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]