PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400047781
Common NameLOC102582832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family CO-like
Protein Properties Length: 386aa    MW: 42403.6 Da    PI: 6.5012
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400047781genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.71.5e-052560439
              zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkgHtv 39
                          + C+ ++   +  fC+++++++C +C +  H  H++
  PGSC0003DMP400047781 25 KSCEYCHLAAALVFCRTDNTFVCLSCDTRLHAHHER 60
                          68*****999*********************88986 PP

2zf-B_box254e-0861106342
              zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                            ++C+ +e+  ++  C+ +   lC  C   +H+       H++vp+
  PGSC0003DMP400047781  61 VWVCEVCEQAAASVTCRADAAALCVACDRDIHSAnplaqrHERVPV 106
                           689*******9*********************66899999999986 PP

3CCT69.86.7e-24308351144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  PGSC0003DMP400047781 308 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 351
                           9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.8E-62263IPR000315B-box-type zinc finger
PROSITE profilePS501199.3572263IPR000315B-box-type zinc finger
CDDcd000215.48E-82763No hitNo description
PROSITE profilePS5011910.9559106IPR000315B-box-type zinc finger
PfamPF006432.1E-660106IPR000315B-box-type zinc finger
CDDcd000213.14E-962106No hitNo description
SMARTSM003362.8E-964106IPR000315B-box-type zinc finger
PfamPF062038.6E-18308350IPR010402CCT domain
PROSITE profilePS5101716.638308350IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGIIREAPNC FPGGWNTGAA AQMAKSCEYC HLAAALVFCR TDNTFVCLSC DTRLHAHHER  60
VWVCEVCEQA AASVTCRADA AALCVACDRD IHSANPLAQR HERVPVVPFY DPVESVVKST  120
AATLLVSITD TTTTTMTTTT GIAPALSKVD ACIGHHDNNN DPWIPPNTIT SKLPLTTEMK  180
AMDFIFTDSE NFLDFDYPVS VDTQSQPHYN SANDSVVPVQ TNTAIKSLPF HHQEKHFEID  240
FTQSHIKSYN TPSLSVSSSS LDVGIVPDGS SISEISYPYM RTMNNSNSSI DLSNSANHQG  300
EKLLGLDREA RVLRYREKKK NRKFEKTIRY ASRKAYAETR PRIKGRFAKR TDGGAGEFDD  360
VDGIFSGAEF IAADSRYGVV PSFLT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400047781
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6366980.0EU636698.1 Solanum lycopersicum CONSTANS-like protein mRNA, complete cds.
GenBankGQ2612280.0GQ261228.1 Solanum lycopersicum cultivar Rio Grande PtoR Hop-interacting protein THI010 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343545.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLM1CMJ00.0M1CMJ0_SOLTU; B-box zinc finger protein 3
STRINGPGSC0003DMT4000706800.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.16e-96CONSTANS-like 5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]