PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400046923
Common NameLOC102605066
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 631aa    MW: 69374.1 Da    PI: 4.6285
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400046923genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.22e-50181461128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lp G+rF+Ptdeel+++yL+ k++g ++++ +vi+e+di+k+ePwdLp  + v+++++ew +F++ d+ky++g+r nrat++gyWkatg
  PGSC0003DMP400046923  18 LPIGYRFRPTDEELINHYLCLKINGCHNQV-DVIREIDICKFEPWDLPdlSVVESNDNEWLYFCPIDRKYQNGQRLNRATERGYWKATG 105
                           699************************999.99**************96448888999******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd+++ ++kg+++g+kktLv+y grap+g++t+Wv+heyr+
  PGSC0003DMP400046923 106 KDRNIATRKGAKIGMKKTLVYYIGRAPEGKRTNWVIHEYRA 146
                           ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-5714169IPR003441NAC domain
PROSITE profilePS5100553.26518169IPR003441NAC domain
PfamPF023657.3E-2319145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MTVPPVGNQV EVPPLNTLPI GYRFRPTDEE LINHYLCLKI NGCHNQVDVI REIDICKFEP  60
WDLPDLSVVE SNDNEWLYFC PIDRKYQNGQ RLNRATERGY WKATGKDRNI ATRKGAKIGM  120
KKTLVYYIGR APEGKRTNWV IHEYRATDKS LDGSHPGQGA FVLCRLFKKN ELKQDENVES  180
SHFDEVEQLV SSPAVGKSPT NDGLSAVALS PIMESESNRS NPPKTSGGKT HDTRLSINSC  240
GNSCTAGDAE DLMLDITSGQ SDLQIEELLG LFRDPSPEPI DWSPLHSQSQ VEFGSSISHG  300
TMTNEISSDQ KDVQCQNGIN DLNTSEFLNS ILVSSDELSY EDSEAELRSI WFASNSINTI  360
TRAPVKDSGT CSVLKSQVTQ EPVRRDFFEP ELLLGNYGET AVMREVNSVA TTVDEAFATP  420
YVRNDHSMAN LDFLNNGYPG EVILSAGSGG MQVDSSLNFD ESNGYSNVGT DSAFGITRRT  480
RQVQNQPDDS QLGSGMQGTT VRRIRYQVKL QAGRVECRMP TDSDQGGADH EGLSTVSESE  540
KFFNEEASTP SAAICSDETQ DTMCKEFKGD CQMAEDLSAN VKDTNGSKRA ALSSFSSSFY  600
ISKVLAVASL LMVFLGVLGC FKLRQSASKL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-45111748170NO APICAL MERISTEM PROTEIN
1ut4_B2e-45111748170NO APICAL MERISTEM PROTEIN
1ut7_A2e-45111748170NO APICAL MERISTEM PROTEIN
1ut7_B2e-45111748170NO APICAL MERISTEM PROTEIN
3swm_A2e-451117411173NAC domain-containing protein 19
3swm_B2e-451117411173NAC domain-containing protein 19
3swm_C2e-451117411173NAC domain-containing protein 19
3swm_D2e-451117411173NAC domain-containing protein 19
3swp_A2e-451117411173NAC domain-containing protein 19
3swp_B2e-451117411173NAC domain-containing protein 19
3swp_C2e-451117411173NAC domain-containing protein 19
3swp_D2e-451117411173NAC domain-containing protein 19
4dul_A2e-45111748170NAC domain-containing protein 19
4dul_B2e-45111748170NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400046923
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135210.0BT013521.1 Lycopersicon esculentum clone 132239F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347316.10.0PREDICTED: NAC domain-containing protein 91
TrEMBLM1CKK60.0M1CKK6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000695110.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.12e-84NAC domain containing protein 62
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]