PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400046203
Common NameLOC102603798
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 555aa    MW: 62063.9 Da    PI: 6.6155
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400046203genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.31.1e-25309362155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k +++WtpeLH++Fv+ave++ G+++A+P++ilelmkv+gLt+++++SHLQk+R+
  PGSC0003DMP400046203 309 KMKVDWTPELHKKFVKAVEKI-GIDQAIPSRILELMKVEGLTRHNIASHLQKFRM 362
                           5689*****************.********************************8 PP

2Response_reg34.31.3e-12201261109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+ d++ ++++ +r+ l++ +y +v ++ +  +al  +  k   +++ ++ ++  ++dG   +k +++++ +lp i+v++  + + + 
  PGSC0003DMP400046203  20 VLLLDKDFNFASQMRSRLQQMDY-IVYTFCNENDALSAISSKSevFHVAIVEVSAGNSDG--GFKFLESAK-DLPTIMVSDIHSINIMM 104
                           8999*******************.***************777778************776..344444544.89*************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           +++ +Ga +fl Kp + ++l++
  PGSC0003DMP400046203 105 KCIALGAVEFLQKPLSDDKLRN 126
                           *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.57E-1516135IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-1516161No hitNo description
SMARTSM004486.2E-618128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011020.57719132IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.7E-820127IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.52E-821131No hitNo description
PROSITE profilePS5129413.674306365IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-25307366IPR009057Homeodomain-like
SuperFamilySSF466894.3E-17307365IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-24309363IPR006447Myb domain, plants
PfamPF002491.3E-6312360IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MVCTENEFLE WKDFPKGLRV LLLDKDFNFA SQMRSRLQQM DYIVYTFCNE NDALSAISSK  60
SEVFHVAIVE VSAGNSDGGF KFLESAKDLP TIMVSDIHSI NIMMKCIALG AVEFLQKPLS  120
DDKLRNIWQH VVHKAFHSGG KNVSESLNPV KESLLSMLEL QPVKREADNE NTNEAVVENQ  180
KTSSSCCDKY PAPSTPQQKQ GVRSVDDGDL QDHAILSNEQ DSGVHEGDTK SVETTCCDSV  240
AETTVLADSS ERLGEAITKE EHDSAADQNM EDPIATCSRS NDNGSACSAD PNKAYGLHSS  300
SGTKANKKKM KVDWTPELHK KFVKAVEKIG IDQAIPSRIL ELMKVEGLTR HNIASHLQKF  360
RMQRRQILPK EDEKRWRHPQ PRDSVQRTYY PHKPVMAFPN YHSNHAPTAG QFYPAWIPPG  420
GYPNGAHMWG SPYYPGWQPP ETWHWNPQPE LYADVWGCPV TPPSLGSCTP YPQNASGFHR  480
AEGIQNRYSI IEKSVDLHPA EEVIDKVVKE AINKPWLPLP LGLKPPSTES VLDALSKQGI  540
STVPPRHHRS HRPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-16307367363ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400046203
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2260150.0AC226015.1 Solanum lycopersicum chromosome 6 clone C06SLm0047M23, complete sequence.
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361171.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_006361172.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
SwissprotQ6LA431e-134APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLM1CIZ00.0M1CIZ0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000683740.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56731531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-137ARR-B family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]