PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400045708
Common NameLOC102598791
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 262aa    MW: 30348.6 Da    PI: 8.3081
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400045708genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.33.3e-4561362128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                            pGfrF Pt+eel+++yL+kk+egk+ el++vi+ v iy+++Pw+Lpk     +  +++++w+fF++r++++a+g r+ r+t+ gyWka
  PGSC0003DMP400045708   6 SPGFRFYPTEEELISFYLHKKLEGKRPELDRVIPVVTIYDFDPWHLPKfhgelC-MGDTEQWFFFVPRQEREARGGRPCRTTNCGYWKA 93 
                           69***************************999***************6566532.34677***************************** PP

                   NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           tg+   v+s++++++g+kk++vfykg+ap+g+kt+W m+eyr+
  PGSC0003DMP400045708  94 TGSPSYVYSSNSKVIGVKKSMVFYKGKAPTGKKTKWKMNEYRA 136
                           *****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-495160IPR003441NAC domain
PROSITE profilePS5100548.0085162IPR003441NAC domain
PfamPF023651.9E-237135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MVEIISPGFR FYPTEEELIS FYLHKKLEGK RPELDRVIPV VTIYDFDPWH LPKFHGELCM  60
GDTEQWFFFV PRQEREARGG RPCRTTNCGY WKATGSPSYV YSSNSKVIGV KKSMVFYKGK  120
APTGKKTKWK MNEYRAIEEE VNSTISIPKL RHEMSLCRIY VISGSFRAFD RRPIATITRE  180
PSKSTINQGG ISMENVTKME AISSPDESLA MEEQDYVNLH HNDQIPIINQ EININSHNNK  240
RVKSNLHDET LISGWEQFNW M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-34516017163NO APICAL MERISTEM PROTEIN
1ut4_B2e-34516017163NO APICAL MERISTEM PROTEIN
1ut7_A2e-34516017163NO APICAL MERISTEM PROTEIN
1ut7_B2e-34516017163NO APICAL MERISTEM PROTEIN
3swm_A2e-34516020166NAC domain-containing protein 19
3swm_B2e-34516020166NAC domain-containing protein 19
3swm_C2e-34516020166NAC domain-containing protein 19
3swm_D2e-34516020166NAC domain-containing protein 19
3swp_A2e-34516020166NAC domain-containing protein 19
3swp_B2e-34516020166NAC domain-containing protein 19
3swp_C2e-34516020166NAC domain-containing protein 19
3swp_D2e-34516020166NAC domain-containing protein 19
4dul_A2e-34516017163NAC domain-containing protein 19
4dul_B2e-34516017163NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400045708
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-161HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362874.10.0PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR32e-81NAC90_ARATH; NAC domain-containing protein 90
TrEMBLM1CHQ70.0M1CHQ7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000677070.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.19e-84NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]