PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400045675
Common NameLOC102585080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family CO-like
Protein Properties Length: 348aa    MW: 38651 Da    PI: 5.1657
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400045675genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.8e-071043336
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                          +++C+ ++  + + fC+ +  +lC +C +++H  
  PGSC0003DMP400045675 10 AKRCDACKATPSTVFCKADMAFLCLTCDSKIHAA 43
                          579*****************************54 PP

2zf-B_box26.21.7e-085398342
              zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                           ++C+ +e+ +++  C+ +   lC +C + +H        H+++p+
  PGSC0003DMP400045675 53 VWVCEVCEHAPASVTCKADAAALCVTCDQDIHAAnplarrHERIPV 98
                          689*****************************66788888998875 PP

3CCT69.86.7e-24283326144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  PGSC0003DMP400045675 283 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 326
                           9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.855855IPR000315B-box-type zinc finger
SMARTSM003368.5E-11855IPR000315B-box-type zinc finger
CDDcd000213.52E-71255No hitNo description
PROSITE profilePS5011910.855198IPR000315B-box-type zinc finger
PfamPF006431.8E-65398IPR000315B-box-type zinc finger
CDDcd000214.71E-85498No hitNo description
SMARTSM003368.4E-105698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787283325IPR010402CCT domain
PfamPF062035.2E-18283325IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MVAESWSTTA KRCDACKATP STVFCKADMA FLCLTCDSKI HAANKLASRH ARVWVCEVCE  60
HAPASVTCKA DAAALCVTCD QDIHAANPLA RRHERIPVVP FYDSASARSP RGAGADENDP  120
HQHEDETEEE EAEAESWLLQ TPNSNTQGIE YKSAEYLFSD VDPYVEMDII ADQKTCTTTM  180
DIAHNQEEYK EDCVVPHVQN NKNEIQLQGP VVDGYPTYEM DFSGGSKPFM YNFTTQSISQ  240
SVSSSSMEVG VVPDHNTMTD VSNTFVRNSA IDGLPNPVSS LDREARVLRY REKRKNRKFE  300
KTIRYASRKA YAETRPRIKG RFAKRTENDM GDSLVASDAS YGVVPSF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400045675
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006357063.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T92e-95COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLM1CHN20.0M1CHN2_SOLTU; B-box zinc finger protein 5
STRINGPGSC0003DMT4000676570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-92CONSTANS-like 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]