PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400044406
Common NameLOC102578736
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 676aa    MW: 74652.5 Da    PI: 6.3332
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400044406genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.1e-29211264155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  PGSC0003DMP400044406 211 KPRVVWSVELHQQFVQAVHQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 264
                           79*******************.********************************8 PP

2Response_reg82.71.2e-27311391109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdD+p+ +++l+++l++ +y ev+ +  +e al +l+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a ++++ + 
  PGSC0003DMP400044406  31 VLVVDDDPTCLKILEKMLRNCHY-EVTKCNRAEVALSYLRENKngFDIVISDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDSKDVVM 117
                           89*********************.***************999999**********************6654.8**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+ +e+l +
  PGSC0003DMP400044406 118 KGVTHGAYDYLIKPVRIEALKN 139
                           ******************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.1E-18311665IPR017053Response regulator B-type, plant
SuperFamilySSF521722.28E-3628152IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.5E-4228182No hitNo description
SMARTSM004481.4E-3129141IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.70930145IPR001789Signal transduction response regulator, receiver domain
PfamPF000728.5E-2531139IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.72E-2832144No hitNo description
Gene3DG3DSA:1.10.10.606.9E-31208269IPR009057Homeodomain-like
PROSITE profilePS5129412.761208267IPR017930Myb domain
SuperFamilySSF466892.87E-20209268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-25211264IPR006447Myb domain, plants
PfamPF002496.9E-9213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MNIGSGSVLS STGSWKSGDV VSDQFPVGLR VLVVDDDPTC LKILEKMLRN CHYEVTKCNR  60
AEVALSYLRE NKNGFDIVIS DVHMPDMDGF KLLEHIGLEM DLPVIMMSAD DSKDVVMKGV  120
THGAYDYLIK PVRIEALKNI WQHVVRKRKQ EWRDNNFDQS GSVEEGDRQQ KQSEDVDYSS  180
SANEGNWKNS KKRKEEDEEG EERDDTSSQK KPRVVWSVEL HQQFVQAVHQ LGIDKAVPKK  240
ILELMNVPGL TRENVASHLQ KYRLYLRRLS CVSQHQNGLN NSFMGRPDAT FGTISSLNGL  300
DLQAIAAAGQ IPAQSLATLQ AAALGRSATK SAISIPLVDQ RNLFSFENSQ VRFPEGQQQL  360
NNSNKQIDLL HGIPTTMEPK QLANLHHPSQ TFVGMNMQVN SMAQHNNSVV MRMPQSQPTA  420
QMLCGANNGS QASRLPLSMQ QSLSSEGIPG AVLARCRIVD NARASVYNPV SQASSMVDFS  480
VNQSKELQNY NFSLGSNSSG MSTLTNRGML QEEANSDIKG SRGFPTNYDI FNDLHQPKLQ  540
NWGLQNVGSS FDSSHHPSIQ GTQGLSSQLL LQQGISSTHN NGQNRNGPIG KPMYTNGEES  600
GHTNLMGGQQ LNSVSRNMLA VKAERFPDAD YQSTNFPEQF GQDDLMSAFL KQQGSVGPVE  660
TEFGFDGYTL DNLPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22207270164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:11691951, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:19039136}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400044406
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by gibberellin. {ECO:0000269|PubMed:20605455}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006363579.10.0PREDICTED: two-component response regulator ARR2-like
RefseqXP_006363580.10.0PREDICTED: two-component response regulator ARR2-like
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLM1CEN40.0M1CEN4_SOLTU; Two-component response regulator
STRINGPGSC0003DMT4000658350.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31912450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.21e-166response regulator 1
Publications ? help Back to Top
  1. Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A
    In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system.
    Funct. Integr. Genomics, 2005. 5(3): p. 175-83
    [PMID:15714319]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Moubayidin L, et al.
    Spatial coordination between stem cell activity and cell differentiation in the root meristem.
    Dev. Cell, 2013. 26(4): p. 405-15
    [PMID:23987513]
  4. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  5. Kurepa J,Li Y,Perry SE,Smalle JA
    Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype.
    BMC Plant Biol., 2014. 14: p. 28
    [PMID:24423196]
  6. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  7. Marín-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  8. D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M
    The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem.
    J. Exp. Bot., 2015. 66(16): p. 5113-22
    [PMID:26163704]
  9. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  10. Moubayidin L, et al.
    A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis.
    Planta, 2016. 243(5): p. 1159-68
    [PMID:26848984]
  11. Muraro D, et al.
    A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana.
    J. Theor. Biol., 2016. 404: p. 182-205
    [PMID:27157127]
  12. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  13. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  14. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  15. Kushwah S,Laxmi A
    The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development.
    Plant Signal Behav, 2017. 12(5): p. e1312241
    [PMID:28467152]
  16. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  17. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  18. Liu B,De Storme N,Geelen D
    Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module.
    Cell Biol. Int., 2017. 41(8): p. 879-889
    [PMID:28618065]
  19. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  20. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  21. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  22. Bustillo-Avendaño E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]
  23. Waldie T,Leyser O
    Cytokinin Targets Auxin Transport to Promote Shoot Branching.
    Plant Physiol., 2018. 177(2): p. 803-818
    [PMID:29717021]