PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400043484
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 258aa    MW: 29646.3 Da    PI: 5.4723
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400043484genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM74.72.3e-2351402128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykv.ePwdLpk.....kvkaeek...ewyfFskrdkkyatgkrknr.atk 79 
                             GfrF+Ptd e v  +L + ++gk ++ + +  ++vd y+  ePwd+ +     + + +++   ++ fF+++ kk+ +++r +r + +
  PGSC0003DMP400043484   5 KEGFRFSPTDAEAV-SFLLRFIAGKLMNDSGFiTTHVDTYSEqEPWDIYShgvpcCNDDDDNdcsQYRFFITKLKKK-SESRYSRdVGN 91 
                           68************.89999999999888787355668876449****73467753333444342334666666655.56788886889 PP

                   NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +g Wk++ k+k+v +k+g ++g kk++ + ++   + ++ dW+m+ey+l
  PGSC0003DMP400043484  92 KGSWKQQDKSKPVRKKGGPVIGYKKSMSYMNKGYYNKKNGDWLMKEYTL 140
                           ******************************98888889*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.6464163IPR003441NAC domain
SuperFamilySSF1019413.14E-224162IPR003441NAC domain
PfamPF023652.4E-146140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGNLKEGFRF SPTDAEAVSF LLRFIAGKLM NDSGFITTHV DTYSEQEPWD IYSHGVPCCN  60
DDDDNDCSQY RFFITKLKKK SESRYSRDVG NKGSWKQQDK SKPVRKKGGP VIGYKKSMSY  120
MNKGYYNKKN GDWLMKEYTL SEYLLDKFDK DCRDYVLCSI KKRTRTKEKL KLVNIVPQDL  180
EDQSSAATVE STSFTEGLQG WGVEYMPQLE LQNDMHEGTS NFVEPLSAPY TFEPTSMLDF  240
DYQYLPADFD CLRSITA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400043484
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015088625.11e-164NAC domain-containing protein 78-like
TrEMBLM1CCG90.0M1CCG9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000645010.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22191254
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.17e-12NAC domain containing protein 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]