PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400043482
Common NameLOC107062934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 252aa    MW: 28852.6 Da    PI: 7.7692
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400043482genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM73.16.9e-2351362128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikev.diy.kvePwdLpk....kvkaeek.ewyfFskrdkkyatgkrknr.atksgy 82 
                           + GfrF+Pt+ e v  +L + ++gk ++ + +i++  d y k ePwd+ +    +++ ++  ++ fF+++ kk+ +++r +r + ++g 
  PGSC0003DMP400043482   5 QEGFRFSPTEAEAV-TFLLRFIAGKLMNDSGFITTHgDTYsKQEPWDIYShgvpCCNDDDCtQYRFFITKLKKK-SKSRYSRdVGNKGN 91 
                           68************.8999999999999888888877766256*****73356644444442555777666665.56788886889*** PP

                   NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           Wk++ k+k+v +++g ++g kk++++  ++  k e+ dW+m+ey+l
  PGSC0003DMP400043482  92 WKQQDKSKPVRKNGGPVIGYKKSMTYM-NKGYKKENGDWLMKEYTL 136
                           **************************9.45555589********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-213158IPR003441NAC domain
PROSITE profilePS5100524.8184159IPR003441NAC domain
PfamPF023651.2E-136136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MENLQEGFRF SPTEAEAVTF LLRFIAGKLM NDSGFITTHG DTYSKQEPWD IYSHGVPCCN  60
DDDCTQYRFF ITKLKKKSKS RYSRDVGNKG NWKQQDKSKP VRKNGGPVIG YKKSMTYMNK  120
GYKKENGDWL MKEYTLSKYL LDKFDKDCRD YVLCSVKKRT RSKGKLKLVN IVPEEELEDQ  180
SSAESTSFTE GLQGGGGKYV TQLELQNDMH EGTSNFVEPL SAPYTFEPMS MLDFDYQYLP  240
ADFDCLRSIT A*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400043482
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015169695.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLM1CCG70.0M1CCG7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000644970.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22191254
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.23e-12Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]