PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400043440
Common NameLOC102593641
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 352aa    MW: 39790.5 Da    PI: 8.871
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400043440genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.56.1e-54161431128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeelvv+yLkk+v+g ++++ ++i+e+d+yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+d
  PGSC0003DMP400043440  16 LPPGFRFHPTDEELVVHYLKKRVAGAPISV-DIIAEIDLYKFDPWELPAKAIFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTD 103
                           79****************************.99***************7777899********************************** PP

                   NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           k+++++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyr+
  PGSC0003DMP400043440 104 KPIFTSgGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRV 143
                           ****9977788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-6411179IPR003441NAC domain
PROSITE profilePS5100561.96116179IPR003441NAC domain
PfamPF023653.7E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MESTDSSTGT RHQPQLPPGF RFHPTDEELV VHYLKKRVAG APISVDIIAE IDLYKFDPWE  60
LPAKAIFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPIFTSG GTQKVGVKKA  120
LVFYGGKPPK GVKTNWIMHE YRVVENKTNN KPPGCDHIVA NKKGSLRLDD WVLCRIYKKN  180
NTQRSIDDLN DMLGSIPQNV PNSILQGVKP SNYGTILLEN ESNMYDGIMN NTNDMINNNN  240
RSIPQFSSKR SMHGGLYWNI DETTTTTEGN HSPNTKRFLV ENNRDDGLNM NNIARITNHE  300
QSSSIANFLS HFPQNTSIQQ EQQEQQVLGS LSDGVVFRQP YNQVTGMNWY S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-7711829171NAC domain-containing protein 19
3swm_B2e-7711829171NAC domain-containing protein 19
3swm_C2e-7711829171NAC domain-containing protein 19
3swm_D2e-7711829171NAC domain-containing protein 19
3swp_A2e-7711829171NAC domain-containing protein 19
3swp_B2e-7711829171NAC domain-containing protein 19
3swp_C2e-7711829171NAC domain-containing protein 19
3swp_D2e-7711829171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400043440
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5738020.0AY573802.1 Lycopersicon esculentum NAC domain protein (NAC-NOR) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362947.10.0PREDICTED: NAC transcription factor 56
SwissprotQ9LD441e-105NAC56_ARATH; NAC transcription factor 56
TrEMBLM1CCC70.0M1CCC7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000644280.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-105NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]