PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400042585
Common NameLOC102598701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 160aa    MW: 17958.4 Da    PI: 4.376
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400042585genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB71.81.1e-221193385
                 NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
                          ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf +y e++ +
  PGSC0003DMP400042585 11 KEDASLPKATMTKIIKEMLPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREDKRTIAPEHVLKALEVLGFGEYTEEVYA 93
                          6899**************************************************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-368139IPR009072Histone-fold
SuperFamilySSF471133.3E-3312140IPR009072Histone-fold
PfamPF008081.6E-201479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MEPMDIVGKT KEDASLPKAT MTKIIKEMLP PDVRVARDTQ DLLIECCVEF INLISSESNE  60
VCNREDKRTI APEHVLKALE VLGFGEYTEE VYAAYEQHKL ETVDTVRAGK WSNNVAEMTE  120
EEALAAQQRM FAEARARMNG VVTVPPKQQD PETEQKLDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B9e-341213512133Transcription Regulator NC2 beta chain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400042585
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755156e-83HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345063.11e-115PREDICTED: protein Dr1 homolog
SwissprotP495921e-87NC2B_ARATH; Protein Dr1 homolog
TrEMBLM1CAC31e-114M1CAC3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000632561e-115(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.41e-91nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]