PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400042429
Common NameLOC102583706
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family SBP
Protein Properties Length: 517aa    MW: 56427.9 Da    PI: 9.0094
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400042429genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.1e-42158233277
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           Cqv+gC +dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+ 
  PGSC0003DMP400042429 158 CQVQGCGKDLSSCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPP 233
                           **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.6E-34152219IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.872155232IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.97E-39156235IPR004333Transcription factor, SBP-box
PfamPF031101.1E-31158231IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MESWSYFSGE KGFVSEESVS VNDGMGRVKN GVMGWELKTQ SSYGMCSSDN QGFHELGSPN  60
LMRKPMFTDQ MRDGFTSSKH WGGGIFGAFS GEDKSSSKLS SSAVDSISKD SSLIDLKLGR  120
FPDHGNIFKS PKSSTSAESI VPAKRMRAGG LNSHKPFCQV QGCGKDLSSC KDYHKRHKVC  180
EVHSKTAKVI VNGIEQRFCQ QCSRFHLLAE FDDGKRSCRK RLAGHNERRR KPPHTGTRFR  240
GTSFATSSFA CQDILGSRYL HQPKYEMSDW YKNVKVEDGV DYSPQLAMPF TNGQLQSKSH  300
FTSYHAKKGC HSFHDGLPAV TTSRINESTN SSLHDMRGSD FVSPSLFHIT STGSEVLHAL  360
DTSSIQGLSG ISNSSNALSL LSSQSQGSSD HSTVFSTSRP LIQSNNNYNV TQASKNVLGL  420
GPQVSAGRMS NTFTNSSGVN SAEGGLDQML FPSNTCGINR IIEGSDLVNP KNQLSCEGGP  480
TIDLLQLSSQ LQRVEHQRFS MQVKQDGNAF PGLRIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291572311084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400042429
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134570.0BT013457.1 Lycopersicon esculentum clone 132113R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345103.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLM1C9Z60.0M1C9Z6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000630460.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-47SBP family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]