PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400041887
Common NameLOC102599201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 561aa    MW: 62600.4 Da    PI: 6.5888
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400041887genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.75.3e-28316370156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k +++WtpeLH++Fv+aveqL G+++A+P++il+lmkv+gLt+++v+SHLQkYR++
  PGSC0003DMP400041887 316 KMKVDWTPELHKKFVQAVEQL-GIDQAIPSRILDLMKVEGLTRHNVASHLQKYRMH 370
                           5689*****************.********************************96 PP

2Response_reg33.81.8e-12201261109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+ d++ + +  +++ lek +y +v ++ + +eal+ +  k   +++ ++ ++  ++dG+  l+ +++++ +lp i+ +   + +++ 
  PGSC0003DMP400041887  20 VLLLDEDSNSAAEMKSRLEKMDY-IVYSFCNESEALTAISSKSegFHVAIVEVSAGNSDGV--LRFLESAK-DLPTIMTSNIHSLSTMM 104
                           799999999**************.***************777777***************5..77777766.9*******9999***** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           +++ +Ga +fl Kp + ++l +
  PGSC0003DMP400041887 105 KCIALGAVEFLQKPLSDDKLKN 126
                           ******************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.12E-1616139IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.8E-1716154No hitNo description
SMARTSM004480.003218128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011022.1119132IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.0E-920126IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.49E-1021131No hitNo description
PROSITE profilePS5129415.085313372IPR017930Myb domain
SuperFamilySSF466892.15E-18314372IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-27314373IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-25316370IPR006447Myb domain, plants
PfamPF002497.2E-8319368IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MICIENELLG WNDFPKGLKV LLLDEDSNSA AEMKSRLEKM DYIVYSFCNE SEALTAISSK  60
SEGFHVAIVE VSAGNSDGVL RFLESAKDLP TIMTSNIHSL STMMKCIALG AVEFLQKPLS  120
DDKLKNIWQH VVHKAFNARK DVSKSLEPVK ESLLSMLQLQ PAKSEADDKS SNGTEPLTAV  180
AESNIEQSSG SDKYPAPSTP QLKQGVRSVD DGDFHDHTIF STDQDSGEHD GDTKSVETTY  240
NNSLAENNVQ TSPTVQQGEI ILKEDNVSSP DQKTETDIAT SSQSNDCPDK IISHFAEPSK  300
ASGPHSSNGT KSNKKKMKVD WTPELHKKFV QAVEQLGIDQ AIPSRILDLM KVEGLTRHNV  360
ASHLQKYRMH RRQILPKEVE RRWPHPQPID SVQRSYYPHK PIMTLPPYHS NHVAPGGQFY  420
PAWVPPASYP NGLQVWGSPY YPGWKPAETW HWTPRPELHA DTWGSPVMSP QFGSYPPYPQ  480
NAGVYRPHGM HNRYSMLEKS FDLHPADEVI DKVIKEAITK PWLPLPLGLK PPSTEGVLDE  540
LSRRGISTIP SQINGSRYRR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-16314374363ARR10-B
5lxu_A2e-16321370655Transcription factor LUX
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400041887
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136480.0BT013648.1 Lycopersicon esculentum clone 132455F, mRNA sequence.
GenBankKC1476340.0KC147634.1 Solanum lycopersicum APRR2-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358579.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLM1C8R30.0M1C8R3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000622320.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56731531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-129ARR-B family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]