PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400040419
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 536aa    MW: 59696.5 Da    PI: 4.384
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400040419genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98.3e-5311281128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           ++pGfrFhPtdeelv +yL++k+ gk+l++ ++i+e+diykvePwdLp  +++k+++ ewyfFs  d+k+ +g ++nrat++gyWk+tg
  PGSC0003DMP400040419   1 MAPGFRFHPTDEELVRYYLRRKIIGKPLRF-DAISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSVLDRKHGNGAKTNRATERGYWKTTG 88 
                           579*************************99.99***************6347788888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd++v++ k+++vg+kktLvf++grapkg++t+Wvmhey+l
  PGSC0003DMP400040419  89 KDRAVHH-KSKVVGMKKTLVFHSGRAPKGQRTNWVMHEYKL 128
                           *******.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100558.1081151IPR003441NAC domain
SuperFamilySSF1019411.96E-612151IPR003441NAC domain
PfamPF023656.6E-283128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MAPGFRFHPT DEELVRYYLR RKIIGKPLRF DAISEIDIYK VEPWDLPGMS RLKTRDLEWY  60
FFSVLDRKHG NGAKTNRATE RGYWKTTGKD RAVHHKSKVV GMKKTLVFHS GRAPKGQRTN  120
WVMHEYKLID EELEKAGVVQ DALVLCRVFQ KSGAGPKNGE KYGAPFVEEE WEDDELEIVP  180
KEEAAEEVEF GDDIYLDGHD LEQILGADSP VDGAPLPLNC YSEGNASNSG DISNSFEEAQ  240
NWLQQPDEQE SFDPAIQQIN ADTNPVKHEF MSEPSNSMNT EDVDYLLDEP VVTATDNLQF  300
SDGAFLEASD LSRPIEVNTS GFDMLEDYLT FFDADDNFQS MGFNPPMMTE GDDHVSDLAS  360
PEEKNIGEVN DQPIAPSEEP EDQKKNVASS SKLEPSKFGS DYKYPFMKQA SCMLGGIPAP  420
PAFASEFPSK SAALRMNSSS EASSSIHVTG FIQITNMTMS GNGMDELVGK HGNYNVILSL  480
GLSQHGDSSA HLESAVSFLP GKTISTVSWC WFYYLFLWVL ILSTTFKVGT LIRAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-45115720174NAC domain-containing protein 19
3swm_B3e-45115720174NAC domain-containing protein 19
3swm_C3e-45115720174NAC domain-containing protein 19
3swm_D3e-45115720174NAC domain-containing protein 19
3swp_A3e-45115720174NAC domain-containing protein 19
3swp_B3e-45115720174NAC domain-containing protein 19
3swp_C3e-45115720174NAC domain-containing protein 19
3swp_D3e-45115720174NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400040419
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345843.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLM1C5720.0M1C572_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000600900.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-129NAC domain containing protein 53
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]