PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400040233
Common NameLOC102583877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family SBP
Protein Properties Length: 457aa    MW: 50448.8 Da    PI: 8.3986
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400040233genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.95e-42102177277
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           Cqv+gC +dl+++k+yh+rhkvCe+hsk+++v+v+g++qrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  PGSC0003DMP400040233 102 CQVQGCGKDLTSCKDYHKRHKVCEIHSKTAKVIVNGIQQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 177
                           **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3298163IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.50599176IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.29E-39101179IPR004333Transcription factor, SBP-box
PfamPF031101.6E-31102175IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MESWSYVSGG KGFVSEESVS VDDGITPCSW SQQGVKNQQV GSQIRDVFGG EDESSSNHSS  60
STYSKDSSLI DLKLGRGRFL DAKNFNLSST KRNRAGGLTS FCQVQGCGKD LTSCKDYHKR  120
HKVCEIHSKT AKVIVNGIQQ RFCQQCSRFH LLAEFDDGKR SCRKRLAGHN ERRRKPHTGL  180
HSGRAGKHFQ PFSGTRFQSS SFATSSFICQ DILGGSLLHQ PKHDMHDWYK NVKVEHCSNY  240
SPQLTRPFTN KHSQPRPHFT SYHTDKHCPA LHDEGITTIT RSKNNESSNS YLNDIGGSDF  300
VSRSLFHSTS IGSEVLNVMD SASPFQGISN SGCALSLLSS QSQDTSNYSS VVPPSAHHLI  360
TPRSNTHYNM TQTSECFPGA SPKGSASTVS NIYNLSEVIS AEGHLEQMLR NNCGSLQGSD  420
YVNTRNLLSC EDGTTIDLLQ LSSQLHQVEH QRHSMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-291011751084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400040233
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006354100.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_006354101.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLM1C4S20.0M1C4S2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000598130.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-45SBP family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]