PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400039764
Common NameLOC102577630, WHY2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Whirly
Protein Properties Length: 111aa    MW: 12274.8 Da    PI: 7.7037
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400039764genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly101.21e-3117268139
                Whirly  68 laskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                           +++++s+effhdp++ +sn+G+vrk+l+++P +dGsG+f++lsv n+ +k+n++f+vPv+ aefav+r++++
  PGSC0003DMP400039764   1 MGTRDSSEFFHDPSMLSSNAGQVRKSLSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFS 72 
                           89*******************************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF544472.51E-311108IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.102.5E-35191IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.2E-26170IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MGTRDSSEFF HDPSMLSSNA GQVRKSLSIK PNADGSGYFI SLSVVNNNLK TNDRFTVPVT  60
TAEFAVMRTA FSFALPHIMG WDRFTNRPSE SISQSPSKVV PQLMEAEWDR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A3e-6019083172StWhy2
3n1i_A3e-6019083172protein StWhy2
3n1j_A3e-6019083172Protein StWhy2
3n1k_A3e-6019083172protein StWhy2
3n1l_A3e-6019083172protein StWhy2
3r9y_A3e-6019083172Why2 protein
3r9z_A3e-6019083172Why2 protein
3ra0_A3e-6019083172Why2 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400039764
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2345040.0HM234504.1 Solanum tuberosum Why2 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015166241.12e-75PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1
SwissprotD9J0342e-76WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A3Q7JMC91e-73A0A3Q7JMC9_SOLLC; Uncharacterized protein
TrEMBLM1C3P31e-75M1C3P3_SOLTU; Uncharacterized protein
STRINGSolyc11g044750.1.11e-74(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.12e-51WHIRLY 2
Publications ? help Back to Top
  1. Desveaux D,Maréchal A,Brisson N
    Whirly transcription factors: defense gene regulation and beyond.
    Trends Plant Sci., 2005. 10(2): p. 95-102
    [PMID:15708347]
  2. Cappadocia L,Sygusch J,Brisson N
    Purification, crystallization and preliminary X-ray diffraction analysis of the Whirly domain of StWhy2 in complex with single-stranded DNA.
    Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun., 2008. 64(Pt 11): p. 1056-9
    [PMID:18997341]
  3. Cappadocia L, et al.
    Crystal structures of DNA-Whirly complexes and their role in Arabidopsis organelle genome repair.
    Plant Cell, 2010. 22(6): p. 1849-67
    [PMID:20551348]
  4. Cappadocia L, et al.
    A conserved lysine residue of plant Whirly proteins is necessary for higher order protein assembly and protection against DNA damage.
    Nucleic Acids Res., 2012. 40(1): p. 258-69
    [PMID:21911368]