PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400039763
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Whirly
Protein Properties Length: 215aa    MW: 23811.5 Da    PI: 10.987
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400039763genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly188.88.8e-59612051139
                Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkq......sfalsatevaelvdlaskesceffhdpaak 83 
                           sv+k+kaal+ ++++ptf+ ldsg +kl+r+G ++l++ ++++erkydWek+q      +  lsatev++l+++++++s+effhdp++ 
  PGSC0003DMP400039763  61 SVFKGKAALSAEPRLPTFNRLDSGGVKLNRRGVIMLTFWPSVGERKYDWEKRQmtqhiaVVCLSATEVGSLISMGTRDSSEFFHDPSML 149
                           79*************************************************98443333468*************************** PP

                Whirly  84 gsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                           +sn+G+vrk+l+++P +dGsG+f++lsv n+ +k+n++f+vPv+ aefav+r++++
  PGSC0003DMP400039763 150 SSNAGQVRKSLSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFS 205
                           *****************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.3E-6049205IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.18E-5054206IPR009044ssDNA-binding transcriptional regulator
PfamPF085367.5E-5562202IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MLKVSRLLHP RNQLLHKKLP GECVKGSIWQ HAINTFAGFS TVRQNVVADG KREGRVFAPY  60
SVFKGKAALS AEPRLPTFNR LDSGGVKLNR RGVIMLTFWP SVGERKYDWE KRQMTQHIAV  120
VCLSATEVGS LISMGTRDSS EFFHDPSMLS SNAGQVRKSL SIKPNADGSG YFISLSVVNN  180
NLKTNDRFTV PVTTAEFAVM RTAFSVRSTN MFLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A1e-102502055154StWhy2
3n1i_A1e-102502055154protein StWhy2
3n1j_A1e-102502055154Protein StWhy2
3n1k_A1e-102502055154protein StWhy2
3n1l_A1e-102502055154protein StWhy2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400039763
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM2345041e-179HM234504.1 Solanum tuberosum Why2 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015166242.11e-151PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2
SwissprotD9J0341e-140WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLM1C3P11e-158M1C3P1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000590321e-158(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97822228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-77WHIRLY 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]