PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400039565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family VOZ
Protein Properties Length: 332aa    MW: 37444.6 Da    PI: 6.4197
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400039565genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ416.16.3e-128532721217
                   VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaata 86 
                           pppsaflgpkcalwdc+rpa gs+w+   qdycs +ha+la neg pg  pv+rp gi+lkd+llf+alsak++gk+vg+pecegaata
  PGSC0003DMP400039565  53 PPPSAFLGPKCALWDCPRPAMGSDWCqksQDYCSDYHASLAPNEGYPGRPPVVRPMGIGLKDNLLFQALSAKAHGKDVGVPECEGAATA 141
                           89***********************944459********************************************************** PP

                   VOZ  87 kspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyein 175
                           kspwna+elfdl+++ege irewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp++++ewhlyeyein
  PGSC0003DMP400039565 142 KSPWNAPELFDLKVVEGEIIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQMMNEFGGLKRSYYMDPQPMKNLEWHLYEYEIN 230
                           ***************************************************************************************** PP

                   VOZ 176 eldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                           ++da+alyrlelklvd+kk +kgk+s+ s+adlqk++grlta
  PGSC0003DMP400039565 231 KYDACALYRLELKLVDGKKIPKGKISNVSVADLQKQMGRLTA 272
                           ****************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MVNNTGVNNL GIATQLDYHS FDLHHEYDQQ YLPGFDALNL CLEDAMPPIH ISPPPSAFLG  60
PKCALWDCPR PAMGSDWCQK SQDYCSDYHA SLAPNEGYPG RPPVVRPMGI GLKDNLLFQA  120
LSAKAHGKDV GVPECEGAAT AKSPWNAPEL FDLKVVEGEI IREWLFFDKP RRAFESGNRK  180
QRSLPDYNGR GWHESRKQMM NEFGGLKRSY YMDPQPMKNL EWHLYEYEIN KYDACALYRL  240
ELKLVDGKKI PKGKISNVSV ADLQKQMGRL TAEFPLDNKR TVKGRVKANM KYVGNIHAAP  300
VPIVPTCEGF DYGNSDPYDY LVDDLDGYFI T*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400039565
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145160.0BT014516.1 Lycopersicon esculentum clone 133906R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361045.10.0PREDICTED: transcription factor VOZ1
RefseqXP_006361046.10.0PREDICTED: transcription factor VOZ1
RefseqXP_006361047.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-145VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM1C3780.0M1C378_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000587350.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-148vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  4. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  5. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]