PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400039559
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 198aa    MW: 22562.4 Da    PI: 8.6374
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400039559genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof108.24.2e-341571258
                zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
                          ++k lkcprC+stn kfCyynny+ sqPry+Ck+C+ryWt+GG lrn+P+Gggr+++
  PGSC0003DMP400039559 15 PTKPLKCPRCESTNIKFCYYNNYNKSQPRYLCKGCKRYWTQGGLLRNLPIGGGRKNK 71
                          67899***********************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.7E-301771IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.9471973IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102157IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-162371IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
NIYIFDNLVM KTTKPTKPLK CPRCESTNIK FCYYNNYNKS QPRYLCKGCK RYWTQGGLLR  60
NLPIGGGRKN KLKITSTSRD DNRAGHGECK VSLTLSSPKI FNPSCPAPTT SDITREKSST  120
SQLYETNIPF SIPTSTTSSN IYNYMENLDS NMEEESTITW QGPIRSSVMN NLSNYWNWED  180
IEALISVDDF KNEFGWN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-136HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016507077.16e-54PREDICTED: dof zinc finger protein DOF2.5-like
TrEMBLM1C3721e-144M1C372_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000587291e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-24TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]